SecReT4
Protein ID: 157368599
T4SS name [ID]Tfc [690]
Gene symbol-
Locus tagSpro_0350
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T4SS(s) in this replicon]
Location [Strand]402225..403709 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDA8G8M0
KEGG IDspe:Spro_0350
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 494 a.a.     [Download]
>gi|157368599|ref|YP_001476588.1| hypothetical protein Spro_0350 [Serratia proteamaculans 568]
MNNTMNKRTFRGRRSLLSLLVVSSLMLVGMNAHADDNDDNGTLFGISLPQVNDSNIGYGKNASGAVSDKL
FYSLGGGSVISQPATRGNMQRLGMNLGWSSDLMCGNFDLKTTIGNQLNGVTDGFKNLMGSVIQGATGAVA
SLPAMAIQRANPGLYEMLTNGVLQGGVAFDKAQLNCQNLSKRMMDMADTGGWSQAAAMEEAKSLVNNGDA
DAVRSMNATEKVTGQSGQTWIGGQKRGGAGQPAIKPTHDLAAAGYNMMNAMPVTSTSSVSGSNCTGGACA
KYASSEEAAAAVVKVLGDTSLRTCKDASQCTSGEGAEQPGSTVAGTGFAPMLEEATKANNEQLAKLVNGA
EKPTTANLAKLKTGSLAVTAGVIKALQRDPDNAALVGRLASELAMADTIETAFIMRRMITTGMSEPNASA
QKVAMEEGDRRIEALDREITALKNEMEMKREISRNAVLTIIDRENNRAETNPQRQSVDSLDTKFNQLAVP
ENDQ
 
Nucleotide Sequence: 1485 bp     [Download]
>ref|NC_009832.1|:402225-403709 hypothetical protein Spro_0350 [Serratia proteamaculans 568]
ATGAATAACACGATGAATAAACGCACTTTCCGAGGTCGGCGCAGCCTGCTGTCTCTGTTGGTTGTCAGCA
GTCTGATGCTGGTCGGCATGAACGCGCACGCTGACGACAATGATGATAACGGTACCTTGTTTGGCATTTC
GTTGCCCCAGGTGAATGACAGCAATATCGGTTACGGGAAGAATGCCAGCGGCGCGGTCTCGGACAAGCTG
TTTTATTCCCTGGGCGGTGGCTCGGTGATCTCACAGCCGGCGACGCGCGGCAACATGCAACGCTTGGGCA
TGAACCTGGGCTGGAGCTCGGATTTGATGTGCGGCAACTTCGATCTGAAGACCACCATTGGTAACCAACT
CAACGGGGTGACGGACGGTTTCAAGAACCTGATGGGTAGCGTTATCCAGGGGGCTACCGGCGCAGTGGCC
AGCCTGCCGGCGATGGCTATCCAGCGTGCCAACCCGGGACTGTATGAAATGCTGACTAACGGAGTGCTGC
AGGGCGGCGTCGCGTTCGACAAGGCGCAGTTGAACTGTCAGAACCTCTCCAAGCGGATGATGGACATGGC
GGATACCGGCGGCTGGAGCCAGGCGGCAGCGATGGAGGAAGCCAAGAGTCTGGTCAATAACGGGGACGCG
GATGCGGTGCGTTCAATGAACGCGACGGAGAAGGTGACCGGGCAATCGGGGCAGACCTGGATCGGCGGTC
AGAAGCGAGGTGGCGCCGGTCAGCCGGCCATCAAACCGACGCACGACCTGGCAGCTGCCGGCTACAACAT
GATGAATGCGATGCCCGTCACCAGTACCTCCAGCGTGTCTGGCAGCAACTGCACTGGCGGCGCCTGTGCC
AAATATGCCAGTAGCGAAGAAGCGGCAGCAGCAGTAGTGAAGGTGCTGGGCGATACCTCACTGCGTACCT
GTAAAGATGCGTCTCAATGTACCAGTGGGGAAGGTGCCGAACAGCCTGGCAGTACCGTGGCCGGCACCGG
TTTTGCCCCGATGCTGGAAGAGGCGACTAAAGCAAATAATGAGCAGTTGGCCAAACTGGTCAACGGGGCA
GAGAAACCCACCACGGCCAACCTGGCCAAACTCAAAACAGGTAGCCTGGCGGTGACCGCCGGGGTTATCA
AGGCGCTGCAACGTGACCCGGATAATGCTGCCCTGGTCGGCCGCCTGGCCAGCGAACTGGCGATGGCGGA
CACCATTGAAACCGCCTTCATTATGCGTCGCATGATCACTACCGGGATGTCCGAGCCCAATGCCTCCGCA
CAGAAAGTGGCGATGGAAGAGGGCGATCGTCGTATCGAGGCGCTGGATCGCGAGATCACTGCGCTGAAGA
ATGAAATGGAAATGAAGCGCGAGATTTCCCGTAACGCGGTGCTGACCATTATTGATCGCGAGAACAACCG
TGCGGAAACCAACCCGCAGCGTCAATCGGTTGACAGCCTGGACACCAAGTTCAACCAGCTGGCCGTACCG
GAAAACGACCAGTAA
 Primer design