SecReT4
Protein ID: 157372307
T4SS name [ID]Tfc [691]
Gene symbol-
Locus tagSpro_4073
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T4SS(s) in this replicon]
Location [Strand]4515629..4517110 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDA8GJ78
KEGG IDspe:Spro_4073
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 493 a.a.     [Download]
>gi|157372307|ref|YP_001480296.1| hypothetical protein Spro_4073 [Serratia proteamaculans 568]
MNNTMNKSLWGRRSLLSLLIAGSLTLAGVNAHADDNDDNGTLFGVSLPQVNDSNVGYGKSASGAVSDKLF
YSLGGGSVISQPATRGNMQRLGMNLGWSSDLMCGNFDLKTTIGNQLNGVTDGFKNLMGSVIQGATGAVAS
LPAMAIQRANPGLYEMLTNGVLQGGVAFDKAQLNCQNLSKRMMDMADSGGWSQAAAMEEAKSLINNGDAD
AVRSMNATEKVTGQSGQTWIGGQKRGGAGQPAIKPTHDLAAAGYNMMNALPVTSTSSVSGSSCTGGACAK
YASSEEAAAAVVKVLGDSSLRTCKDAAQCTSGEGSEQPGSTVAGTGFAPMLEEATKENNQQLAKLVNGAE
KPTAANLAKLKTGSLAVTAGVIKALQRDPDNAALVGRLASELAMADTIETAFIMRRMVTTGMSEPNAAVQ
KMAMEEGDRRIEALDREITALKNEMEMKREIARNAVLTIIDRENNRAETNPQRQSVDSPDTKFNQLAVPE
SDQ
 
Nucleotide Sequence: 1482 bp     [Download]
>ref|NC_009832.1|:c4517110-4515629 hypothetical protein Spro_4073 [Serratia proteamaculans 568]
ATGAATAACACGATGAATAAATCTCTCTGGGGACGGCGCAGCCTGCTGTCTCTGCTGATTGCCGGCAGCC
TGACGCTGGCCGGCGTGAACGCACACGCTGACGACAATGATGATAACGGCACCCTGTTTGGTGTTTCGTT
GCCGCAAGTCAATGACAGCAACGTAGGGTACGGGAAGAGCGCCAGCGGCGCAGTCTCGGACAAGCTGTTT
TACTCCCTGGGCGGCGGGTCGGTGATTTCACAGCCGGCGACGCGTGGCAACATGCAGCGGCTGGGTATGA
ACCTGGGCTGGAGCTCGGATTTGATGTGCGGCAATTTCGACTTGAAGACCACCATTGGCAACCAGCTCAA
CGGGGTGACGGACGGCTTCAAGAACCTGATGGGCAGTGTTATCCAGGGGGCTACCGGTGCGGTGGCCAGC
CTGCCGGCGATGGCTATCCAGCGAGCCAACCCGGGATTGTATGAAATGCTGACCAACGGGGTACTGCAGG
GCGGCGTCGCCTTCGACAAGGCACAGTTGAACTGTCAGAACCTCTCCAAACGGATGATGGATATGGCAGA
CTCCGGTGGCTGGAGCCAGGCCGCTGCGATGGAGGAAGCGAAAAGCCTGATCAATAACGGGGATGCTGAT
GCGGTGCGGTCGATGAATGCCACGGAGAAGGTAACCGGGCAATCCGGCCAGACCTGGATCGGCGGTCAGA
AGCGGGGCGGCGCCGGCCAGCCTGCCATCAAGCCGACGCACGACCTGGCGGCAGCCGGCTACAACATGAT
GAATGCGCTGCCGGTCACCAGTACCTCGAGCGTATCCGGCAGCAGTTGCACCGGCGGTGCCTGTGCCAAA
TATGCCAGTAGTGAAGAAGCGGCCGCTGCCGTGGTGAAGGTGTTGGGGGATTCTTCTCTGCGTACCTGTA
AAGATGCGGCGCAATGTACCAGTGGGGAAGGCAGCGAACAGCCCGGCAGTACCGTGGCCGGCACGGGTTT
TGCCCCGATGCTGGAAGAAGCGACGAAGGAAAATAACCAGCAGTTGGCCAAACTGGTCAACGGGGCAGAG
AAACCCACCGCGGCCAACCTGGCCAAACTCAAAACGGGCAGCCTGGCGGTGACAGCCGGCGTCATCAAGG
CACTGCAGCGCGACCCGGATAATGCTGCACTGGTCGGCCGCCTGGCTAGCGAACTGGCGATGGCGGACAC
CATTGAAACGGCCTTTATCATGCGCCGTATGGTCACCACCGGCATGTCAGAGCCTAATGCTGCTGTCCAG
AAAATGGCGATGGAAGAGGGCGATCGACGTATCGAGGCGCTGGACCGTGAAATCACGGCGCTGAAGAACG
AGATGGAAATGAAGCGCGAGATTGCGCGTAACGCAGTGCTGACCATCATCGATCGTGAGAATAACCGTGC
GGAAACCAACCCGCAGCGTCAGTCGGTTGACAGCCCGGACACCAAGTTCAACCAGTTGGCCGTACCGGAA
AGCGACCAGTAA
 Primer design