SecReT4
Protein ID: 157372325
T4SS name [ID]Tfc [691]
Gene symbol-
Locus tagSpro_4091
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T4SS(s) in this replicon]
Location [Strand]4549755..4550120 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDA8GJ96
KEGG IDspe:Spro_4091
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 8.2e-44, Aligned region: 1..117
Protein Sequence: 121 a.a.     [Download]
>gi|157372325|ref|YP_001480314.1| hypothetical protein Spro_4091 [Serratia proteamaculans 568]
MQTIRFLPDRLNAEPVVFRGFTTPEMGLAALAGVGLGLLVSLPFFPLAGWVVIPTGMLVTPLLVIWFGGS
RLTRLKRGKPENYIWQRLEARKRRMGWGDPTLIIDKQGWSLRRSRVVKRSK
 
Nucleotide Sequence: 366 bp     [Download]
>ref|NC_009832.1|:c4550120-4549755 hypothetical protein Spro_4091 [Serratia proteamaculans 568]
ATGCAGACTATCCGTTTTTTGCCTGACCGTCTTAACGCTGAACCTGTCGTCTTCCGGGGCTTTACCACCC
CGGAGATGGGGTTGGCGGCGTTGGCGGGTGTAGGGCTGGGTCTGCTCGTGTCGTTGCCTTTTTTCCCCCT
TGCCGGCTGGGTTGTGATACCCACCGGCATGCTGGTAACCCCTCTCCTCGTCATCTGGTTTGGTGGCAGC
CGGCTGACGCGCCTCAAGCGCGGTAAACCGGAGAATTATATCTGGCAGCGCCTCGAGGCGCGTAAACGTC
GCATGGGGTGGGGTGATCCCACCCTGATTATCGACAAACAGGGCTGGTCGTTGCGTCGCAGCCGCGTTGT
TAAGAGGTCCAAATGA
 Primer design