SecReT4
Protein ID: 157372333
T4SS name [ID]Tfc [691]
Gene symbol-
Locus tagSpro_4099
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T4SS(s) in this replicon]
Location [Strand]4555869..4556561 [-]
Productlytic transglycosylase
Component typeTfc4
UniProt IDA8GJA4
KEGG IDspe:Spro_4099
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 230 a.a.     [Download]
>gi|157372333|ref|YP_001480322.1| lytic transglycosylase [Serratia proteamaculans 568]
MDTRRILTRGLLPLFALLSCGGAATVHASTQQVPSGYREVALRHGVPPESLYSVALAETSMAPKSIVSVT
RGAGPAPDVERPWPWTINVAGKGYRYASRLQAWEALQRFLKTHPRKRIDVGIAQVNLGWNGHHFTSTWEA
FDPYTNLNAAATILRECYDRNPGSWLVAAGCYHHPAGGAPAARYKSIVSGKLARLNGRASAPTRVASSTP
TPTALPAQTAALTWIEPRSQ
 
Nucleotide Sequence: 693 bp     [Download]
>ref|NC_009832.1|:c4556561-4555869 lytic transglycosylase [Serratia proteamaculans 568]
ATGGACACTCGCCGCATTCTGACCCGGGGGCTATTGCCCCTGTTCGCCCTCCTGAGTTGCGGGGGGGCGG
CAACCGTTCATGCGTCCACCCAGCAGGTCCCTTCCGGCTACCGGGAGGTGGCGCTGCGCCACGGGGTGCC
GCCGGAGTCCCTGTACTCGGTGGCGCTGGCCGAGACCTCGATGGCGCCGAAAAGCATTGTTTCGGTGACC
CGCGGGGCCGGTCCGGCCCCGGATGTGGAGCGCCCCTGGCCCTGGACAATAAACGTGGCAGGCAAAGGGT
ACCGCTACGCCAGCCGTCTGCAGGCCTGGGAAGCCCTGCAGCGCTTTTTGAAAACACATCCTCGCAAACG
TATTGATGTCGGGATTGCCCAGGTCAATCTGGGCTGGAACGGCCATCACTTCACGTCGACCTGGGAGGCG
TTTGATCCGTACACCAACCTCAACGCGGCGGCGACCATCCTGCGGGAATGTTATGACCGCAACCCCGGGA
GTTGGCTGGTTGCTGCCGGGTGTTACCACCACCCTGCCGGCGGTGCCCCGGCAGCCCGGTATAAATCCAT
TGTGAGCGGCAAGCTGGCACGCCTGAACGGCAGGGCATCTGCCCCGACCCGGGTGGCCAGTTCAACCCCC
ACGCCCACGGCATTACCGGCACAAACGGCAGCGCTGACCTGGATTGAACCACGGAGCCAATAA
 Primer design