SecReT4
Protein ID: 157372396
T4SS name [ID]Tfc [692]
Gene symbol-
Locus tagSpro_4163
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T4SS(s) in this replicon]
Location [Strand]4617751..4619235 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDA8GJG7
KEGG IDspe:Spro_4163
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 494 a.a.     [Download]
>gi|157372396|ref|YP_001480385.1| hypothetical protein Spro_4163 [Serratia proteamaculans 568]
MNNTMNKRTFRGRRSMLSLLVVSSLMLVGMYAHADDNDDNGTLFGISLPQVNDSNIGYGKNASGAVSDKL
FYSLGGGSVISQPATRGNMKRLGMNLGWSSDLMCGNFDLKTTIGNQLNGVTDGFKNLMGSVIQGATGAVA
SLPAMAIQRANPGLYEMLTNGVLQGGVAFDKAQLNCQNLSKRMMDMADTGGWSQAAAMEEAKSLVNNGDA
DAVRSMNATEKVTGQSGQTWIGGQKRGGSGQPAIKPTHDLTAAGYNMMNALPVTSTSNVSGSSCTGGACA
KYASSEEAAAAVVKVLGDTSLRTCKDASQCTSGEGSEQPGSTVAGTGFAPMLEEATKANNEQLAKLVNGA
EKPTTANLAKLKTGSLAVTAGVIKALQRDPDNAALVGRLASELAMADTIETAFIMRRMITTGMSEPNASA
QKVAMEEGDRRIEALDREITALKNEMEMKREISRNAVLTIIVRENNRAETNPQRQSVDSPDTKFNQLAVP
ESDQ
 
Nucleotide Sequence: 1485 bp     [Download]
>ref|NC_009832.1|:c4619235-4617751 hypothetical protein Spro_4163 [Serratia proteamaculans 568]
ATGAATAACACGATGAATAAACGCACTTTCCGAGGCCGGCGCAGCATGCTGTCTCTGTTGGTTGTCAGCA
GTCTGATGCTGGTCGGCATGTACGCGCACGCTGACGACAATGATGATAACGGTACCCTGTTTGGCATTTC
GTTGCCCCAGGTGAATGACAGCAATATCGGTTACGGGAAGAATGCCAGCGGCGCGGTCTCGGACAAGCTG
TTTTATTCCCTGGGCGGTGGCTCGGTGATATCGCAACCGGCGACACGCGGCAACATGAAACGCCTGGGAA
TGAACTTGGGCTGGAGCTCGGATTTGATGTGCGGCAACTTCGATCTGAAAACGACGATCGGTAATCAGCT
TAATGGTGTCACCGACGGCTTCAAGAACCTGATGGGCAGTGTTATCCAGGGCGCCACCGGCGCGGTGGCC
AGCCTACCTGCGATGGCTATCCAGCGTGCTAACCCGGGGCTGTATGAAATGCTGACCAACGGGGTGCTGC
AGGGCGGTGTCGCGTTCGACAAAGCGCAGCTGAACTGTCAGAACCTCTCGAAGCGCATGATGGACATGGC
GGATACCGGCGGCTGGAGCCAGGCGGCAGCGATGGAGGAAGCCAAGAGTCTGGTCAATAACGGGGACGCG
GATGCGGTGCGTTCAATGAACGCGACGGAGAAGGTGACAGGGCAATCGGGGCAGACCTGGATCGGGGGGC
AGAAGCGAGGTGGCTCCGGTCAGCCGGCCATCAAACCGACGCACGACCTGACAGCCGCCGGCTACAACAT
GATGAATGCGCTGCCCGTCACCAGCACGTCCAACGTATCCGGCAGCAGTTGCACCGGTGGAGCTTGTGCC
AAGTATGCCAGCAGCGAAGAAGCGGCAGCCGCAGTGGTGAAGGTGTTGGGCGATACCTCACTGCGTACCT
GTAAGGATGCGTCTCAATGTACCAGTGGGGAAGGGAGCGAACAGCCCGGCAGTACCGTGGCCGGCACAGG
TTTTGCTCCGATGCTGGAAGAGGCGACAAAAGCAAATAACGAGCAGTTGGCCAAACTGGTCAACGGAGCA
GAGAAACCCACCACGGCCAACCTGGCCAAGCTCAAAACGGGCAGCCTGGCGGTGACCGCCGGGGTTATCA
AGGCGCTGCAGCGTGACCCGGATAATGCTGCTCTGGTCGGCCGCCTGGCCAGCGAACTGGCAATGGCGGA
TACCATTGAAACGGCCTTTATTATGCGTCGCATGATCACTACCGGGATGTCCGAGCCCAATGCCTCCGCA
CAGAAAGTGGCGATGGAAGAGGGCGATCGTCGTATCGAGGCGCTGGATCGCGAGATAACTGCGCTGAAGA
ATGAAATGGAAATGAAGCGCGAGATTTCCCGTAACGCGGTGCTGACCATTATCGTTCGCGAGAACAACCG
TGCGGAAACCAACCCGCAGCGTCAATCGGTTGACAGCCCGGACACCAAGTTCAACCAGCTGGCCGTACCG
GAAAGCGACCAGTAA
 Primer design