SecReT4
Protein ID: 157372407
T4SS name [ID]Tfc [692]
Gene symbol-
Locus tagSpro_4174
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T4SS(s) in this replicon]
Location [Strand]4629572..4629937 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDA8GJH8
KEGG IDspe:Spro_4174
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 8.6e-44, Aligned region: 1..117
Protein Sequence: 121 a.a.     [Download]
>gi|157372407|ref|YP_001480396.1| hypothetical protein Spro_4174 [Serratia proteamaculans 568]
MQTIRFLPDRLNAEPVVFRGFTTPEMGLAALAGVGLGLLVSLPFFPLAGWVVIPTGMLVTPLLVIWFGGS
RLTRLKRGKPENYIWQRLEARKRRMGWGDPTLIIDKQGWSLRRSRVVKRST
 
Nucleotide Sequence: 366 bp     [Download]
>ref|NC_009832.1|:c4629937-4629572 hypothetical protein Spro_4174 [Serratia proteamaculans 568]
ATGCAGACTATCCGATTTTTACCTGACCGCCTCAATGCCGAACCAGTCGTCTTCCGGGGCTTTACCACCC
CGGAGATGGGGTTGGCGGCGCTGGCGGGCGTAGGGCTGGGTCTGCTCGTGTCGTTGCCGTTTTTTCCCCT
TGCCGGCTGGGTTGTGATACCCACCGGCATGCTGGTGACACCCCTCCTCGTCATCTGGTTTGGTGGCAGC
CGGCTGACGCGCCTCAAGCGCGGTAAACCGGAGAATTATATCTGGCAGCGCCTCGAGGCGCGTAAACGTC
GCATGGGGTGGGGTGATCCCACCCTGATTATCGACAAACAGGGCTGGTCGTTGCGCCGTAGCCGCGTTGT
TAAGAGGTCAACATGA
 Primer design