SecReT4
Protein ID: 157372410
T4SS name [ID]Tfc [692]
Gene symbol-
Locus tagSpro_4177
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T4SS(s) in this replicon]
Location [Strand]4630625..4630954 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDA8GJI1
KEGG IDspe:Spro_4177
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 4.8e-31, Aligned region: 22..104
Protein Sequence: 109 a.a.     [Download]
>gi|157372410|ref|YP_001480399.1| hypothetical protein Spro_4177 [Serratia proteamaculans 568]
MPITVVRGLGAGCLLGLTLLTALPAQAAEKDELASAQRMLIQVQAALERARVAAVQADPSERGRFFFDYA
RATADLKTINAGIDRYLEPSRAQPRDGSAVAGNYRRERP
 
Nucleotide Sequence: 330 bp     [Download]
>ref|NC_009832.1|:c4630954-4630625 hypothetical protein Spro_4177 [Serratia proteamaculans 568]
ATGCCTATCACCGTTGTTCGCGGTCTCGGCGCCGGCTGTTTGCTGGGGCTGACTCTGCTGACTGCCCTGC
CTGCCCAGGCTGCTGAAAAAGATGAGCTGGCGTCTGCCCAGCGCATGTTGATTCAGGTGCAGGCGGCGCT
TGAACGTGCACGCGTTGCCGCCGTTCAGGCTGATCCGTCTGAGCGTGGCCGTTTCTTCTTTGACTATGCC
CGCGCCACTGCCGACCTCAAGACCATCAATGCCGGTATCGATCGTTACCTCGAGCCTTCACGCGCGCAAC
CCCGTGATGGCAGCGCCGTGGCCGGCAACTACCGGCGGGAGCGTCCCTGA
 Primer design