SecReT4
Protein ID: 157372411
T4SS name [ID]Tfc [692]
Gene symbol-
Locus tagSpro_4178
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T4SS(s) in this replicon]
Location [Strand]4631722..4632480 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDA8GJI2
KEGG IDspe:Spro_4178
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 2e-72, Aligned region: 49..249
Protein Sequence: 252 a.a.     [Download]
>gi|157372411|ref|YP_001480400.1| hypothetical protein Spro_4178 [Serratia proteamaculans 568]
MSQTVNNQPQQPVQPRKHGLLYNVLWGWPWMLIGMFFASLFVSLVIEYVGMAFFWPELGASHSEAVMNTE
LGYLSSEFTRSLLLSEPSVTVTRWIMMAYQWTFVDSGFLDWIQSVYDTQVHSQNAVARELNSWSGWLAAT
LKEYLVATVYVTVITLVRTTILVLSIPQFIIVVLVALTEGLGRRDVRRYGAGYESSFVYHHAKRMVKPAV
YIPCMLYLSWPMAVYPNLLLLPAAILLGVAVTVTTASFKKYL
 
Nucleotide Sequence: 759 bp     [Download]
>ref|NC_009832.1|:c4632480-4631722 hypothetical protein Spro_4178 [Serratia proteamaculans 568]
ATGTCACAAACGGTGAATAATCAGCCTCAGCAGCCCGTACAACCCCGCAAACATGGACTGCTATACAACG
TGCTGTGGGGCTGGCCATGGATGCTGATCGGGATGTTTTTTGCCTCGTTGTTTGTGAGCCTGGTGATTGA
ATATGTCGGGATGGCCTTCTTCTGGCCAGAGCTGGGTGCGTCGCACAGTGAAGCCGTGATGAACACCGAG
TTGGGGTACCTGTCATCGGAGTTTACGCGCAGCTTGCTGCTGTCTGAACCTTCGGTGACTGTCACCCGTT
GGATTATGATGGCGTATCAATGGACCTTCGTGGACAGCGGCTTTTTGGACTGGATCCAAAGTGTGTATGA
CACGCAGGTGCACAGCCAGAATGCCGTGGCCAGGGAGCTGAACAGTTGGAGTGGTTGGTTGGCCGCCACG
CTCAAAGAGTACCTGGTGGCGACGGTCTATGTCACCGTCATCACCCTGGTGCGGACGACTATTTTGGTGC
TATCTATCCCGCAGTTTATCATCGTGGTATTAGTCGCGTTGACGGAAGGCCTGGGGCGGCGTGATGTTCG
GCGTTATGGCGCCGGCTATGAATCGAGCTTTGTCTACCATCATGCTAAACGCATGGTAAAGCCAGCAGTG
TACATCCCCTGCATGCTGTATCTGTCGTGGCCAATGGCGGTATACCCCAATCTGCTGTTGTTGCCGGCGG
CTATTTTGCTCGGTGTTGCGGTGACAGTGACCACGGCCTCCTTCAAAAAATACCTGTAG
 Primer design