SecReT4
Protein ID: 157372415
T4SS name [ID]Tfc [692]
Gene symbol-
Locus tagSpro_4182
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T4SS(s) in this replicon]
Location [Strand]4635686..4636378 [-]
Productlytic transglycosylase
Component typeTfc4
UniProt IDA8GJI6
KEGG IDspe:Spro_4182
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 230 a.a.     [Download]
>gi|157372415|ref|YP_001480404.1| lytic transglycosylase [Serratia proteamaculans 568]
MDTRRVLTQGLFHLFACLTSVGAGAVHAATQQVPSGYREVALRHGVPPESLYSVALAETSMAPKSIVSVT
RGAGLAPDVERPWPWTINVAGKGYRYASRLQAWEALQRFLKTHPRKRIDVGIAQVNLGWNGHHFTSTWEA
FEPYTNLNAAAAILRECYDRNPGSWLTAAGCYHHPAGGAPAARYKSIVSGKLARLNSRTSAPTRVANTTL
TPMVLPAQTAALTWIEPRSQ
 
Nucleotide Sequence: 693 bp     [Download]
>ref|NC_009832.1|:c4636378-4635686 lytic transglycosylase [Serratia proteamaculans 568]
ATGGACACTCGCCGCGTTCTGACCCAGGGGCTATTTCACCTGTTTGCCTGCCTCACCTCTGTGGGCGCGG
GAGCGGTTCATGCTGCCACCCAGCAGGTACCTTCCGGTTATCGGGAGGTAGCGTTGCGTCATGGGGTTCC
TCCGGAGTCCCTGTATTCGGTGGCGTTGGCCGAGACATCGATGGCGCCGAAAAGCATCGTCTCGGTAACC
CGCGGCGCCGGTCTGGCCCCGGATGTGGAGCGCCCCTGGCCCTGGACCATCAATGTTGCCGGCAAAGGGT
ATCGCTATGCCAGCCGACTGCAGGCCTGGGAAGCCTTACAGCGTTTTTTGAAAACACATCCCAGAAAACG
CATCGATGTTGGAATTGCCCAGGTCAATCTGGGCTGGAACGGCCATCACTTTACGTCGACATGGGAGGCG
TTTGAGCCGTACACCAACCTCAACGCGGCGGCGGCCATCCTGCGGGAGTGCTATGACCGTAATCCTGGGA
GTTGGCTGACAGCCGCCGGTTGCTATCACCACCCCGCTGGCGGCGCGCCTGCTGCCCGTTATAAATCCAT
TGTGAGCGGCAAGTTGGCACGCCTAAACAGCAGGACATCCGCCCCGACCCGGGTGGCGAATACAACCCTT
ACGCCCATGGTGTTACCGGCACAAACGGCGGCACTGACTTGGATTGAACCACGGAGCCAATAA
 Primer design