SecReT4
Protein ID: 157412017
T4SS name [ID]Tra_F [575]
Gene symboltrhL
Locus tagAPECO1_O1R3
StrainEscherichia coli APEC O1
Repliconplasmid pAPEC-O1-R [GenBank: NC_009838] [Browse all T4SS(s) in this replicon]
Location [Strand]2396..2746 [+]
ProductTrhL
Component typeTraL_F
UniProt IDQ19NT1
KEGG IDecv:APECO1_O1R3
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 2.7e-06, Aligned region: 22..92
Protein Sequence: 116 a.a.     [Download]
>gi|157412017|ref|YP_001481357.1| TrhL [Escherichia coli APEC O1]
MRGFIPLSGFLMSKQNDVPQHTYRFPFRINMPLLILFWDAKKIGLAFILVAFGNIFECFGFSVVAAVVYW
IAYNKAAESGIRGLLKHRLWWLGFLPGKAVFSSRYFNDPFIRDLYS
 
Nucleotide Sequence: 351 bp     [Download]
>gi|157412014|ref|NC_009838.1|:2396-2746 Escherichia coli APEC O1 plasmid pAPEC-O1-R, complete sequence
ATGAGGGGGTTCATCCCCCTCTCTGGATTTTTAATGAGTAAGCAGAACGACGTTCCTCAGCATACCTATA
GATTCCCTTTCAGGATCAACATGCCTCTACTGATTTTGTTTTGGGATGCAAAAAAAATAGGGCTTGCATT
CATTCTGGTTGCATTTGGGAATATCTTCGAATGCTTCGGGTTTTCTGTTGTAGCAGCGGTTGTATATTGG
ATTGCGTATAACAAAGCAGCTGAGTCAGGAATAAGAGGATTGCTAAAACACAGACTCTGGTGGCTCGGTT
TTTTGCCAGGTAAAGCAGTTTTTAGTAGCCGTTATTTCAACGATCCATTTATCAGAGATTTGTATTCTTG
A
 Primer design