SecReT4
Protein ID: 157412162
T4SS name [ID]Tra_F [575]
Gene symboltrhF
Locus tagAPECO1_O1R147
StrainEscherichia coli APEC O1
Repliconplasmid pAPEC-O1-R [GenBank: NC_009838] [Browse all T4SS(s) in this replicon]
Location [Strand]167666..168712 [-]
Productpilus assembly protein
Component typeTraF_F
UniProt IDQ19ND5
KEGG IDecv:APECO1_O1R147
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.1e-50, Aligned region: 45..267
Thioredoxin_2 [PF13098], Evalue: 2.2e-07, Aligned region: 174..265
Protein Sequence: 348 a.a.     [Download]
>gi|157412162|ref|YP_001481503.1| pilus assembly protein [Escherichia coli APEC O1]
MTRIALAPSKMVLLMSLVITGAHASPEQPLIKDTPFVSGQAYKKGFFWYDDPAKKSEAEEEKVLPPTGAA
SSPSKEEKVDLNSKWLKENMPRLLTQAMDNPTAENLSRYYTAQRLMLDISTRFSDKSKDYFLKNPMMSEK
RRQPVEKVALDAHRTVVEKNQQTVMKDIFTKSGLFFFFQSTCQFCHEESQILQFMQNYYSVDILPISMDG
RPLHNGLFQDFNIPNAQIIDQFKIREVPTIFLVSKDGTSAQRISEGMISADELKNTIILAAKGMNLIDDA
SFQSTLDIKRQYTIGDDGVITVNKSEMESDPFLLQKIMDQKLEGYDMPTADPVNYLNAGGSFGGTYAQ
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|157412014|ref|NC_009838.1|:c168712-167666 Escherichia coli APEC O1 plasmid pAPEC-O1-R, complete sequence
ATGACTCGTATTGCATTAGCGCCTTCAAAGATGGTTTTGCTTATGTCTTTGGTAATTACTGGTGCCCACG
CCAGCCCTGAGCAACCCCTAATAAAAGATACGCCCTTTGTATCAGGCCAGGCTTATAAGAAGGGTTTCTT
CTGGTATGACGATCCTGCTAAAAAAAGCGAAGCTGAAGAAGAAAAGGTTTTGCCACCAACCGGTGCTGCT
AGCTCGCCTTCAAAAGAGGAAAAGGTAGATTTAAATTCAAAATGGCTAAAAGAGAATATGCCTCGACTGT
TAACGCAGGCAATGGATAACCCTACCGCAGAAAATCTATCACGTTATTACACGGCGCAAAGGTTAATGCT
GGATATCAGTACGCGTTTTTCTGACAAATCAAAAGATTATTTTCTTAAAAACCCGATGATGTCTGAAAAA
CGCAGGCAACCAGTGGAAAAGGTGGCACTGGATGCTCACCGCACTGTTGTTGAAAAAAATCAGCAAACGG
TAATGAAAGATATCTTTACTAAGTCAGGTTTATTTTTCTTTTTCCAGAGTACTTGCCAGTTTTGCCACGA
AGAGAGCCAAATACTTCAATTTATGCAGAACTATTATTCGGTAGATATTCTTCCAATCAGTATGGATGGA
AGGCCATTGCATAATGGCCTTTTTCAGGATTTTAACATCCCCAATGCACAAATTATTGATCAATTTAAAA
TTCGAGAGGTACCTACAATTTTCCTGGTTTCAAAGGATGGGACATCAGCTCAGCGCATTAGTGAAGGCAT
GATCTCCGCTGATGAATTAAAGAACACTATTATACTTGCCGCGAAGGGCATGAATCTGATCGATGACGCT
TCGTTTCAGTCAACTCTAGATATTAAAAGGCAATATACCATCGGTGATGATGGCGTTATTACCGTTAATA
AATCCGAAATGGAATCAGACCCATTCTTACTTCAAAAAATAATGGACCAAAAACTCGAAGGCTATGACAT
GCCTACGGCCGATCCGGTCAATTATCTCAATGCTGGCGGCAGTTTTGGAGGCACTTATGCGCAGTAA
 Primer design