SecReT4
Protein ID: 157418142
T4SS name [ID]Tra_F [111]
Gene symboltraX
Locus tagAPECO1_O1CoBM59
StrainEscherichia coli APEC O1
Repliconplasmid pAPEC-O1-ColBM [GenBank: NC_009837] [Browse all T4SS(s) in this replicon]
Location [Strand]49848..50594 [+]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDQ27TG3
KEGG IDecv:APECO1_O1CoBM59
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 4.1e-52, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|157418142|ref|YP_001481214.1| conjugal transfer pilus acetylation protein TraX [Escherichia coli APEC O1]
MTTDNTNTTRNDSLAARTDTWLQSLLVWSPGQRDIIKTVALVLMVLDHANRILHLDQSWMFLVGRGAFPL
FALVWGLNLSRHTHIRQEAINRLWGWAVIAQFAYYLAGFPWYEGNILFAFAVAAQVLTWCETRTWWRSAE
TMLLLAMWLPFSGTSYGIAGLLMLAVSHRLYRAEDRMERLALVACLLAVIPALNLATSDAAAVAGLVMTV
LTVGLVSCTGKSLPRFWYGDFFPTFYACHLTVLGVLAV
 
Nucleotide Sequence: 747 bp     [Download]
>gi|157418083|ref|NC_009837.1|:49848-50594 Escherichia coli APEC O1 plasmid pAPEC-O1-ColBM, complete sequence
ATGACAACGGATAACACGAACACAACACGTAATGATTCACTGGCTGCCCGGACCGATACCTGGTTGCAGT
CGTTGCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTTCTGGA
CCATGCAAACCGCATTCTGCATCTGGACCAGTCGTGGATGTTTCTGGTCGGGCGTGGGGCCTTTCCGCTG
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATACGCATATCCGGCAGGAGGCCATTAACCGGCTGT
GGGGATGGGCGGTGATTGCCCAGTTCGCATATTATCTGGCCGGCTTTCCTTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTTGCGGCACAGGTGCTGACATGGTGTGAAACGCGCACCTGGTGGCGTTCCGCAGAG
ACCATGTTGCTTCTGGCAATGTGGTTGCCTTTCTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCAGTCAGCCACAGGCTGTACCGGGCGGAAGACAGAATGGAACGTCTGGCGCTGGTCGCCTGCCTGCT
GGCTGTTATTCCGGCGCTTAACCTTGCCACCAGTGATGCAGCGGCGGTGGCCGGCCTTGTGATGACGGTG
CTGACTGTTGGTCTGGTGTCCTGTACAGGGAAATCACTACCCCGTTTCTGGTACGGGGATTTTTTCCCGA
CGTTCTATGCCTGTCATCTTACTGTGCTGGGCGTTCTGGCTGTGTGA
 Primer design