SecReT4
Protein ID: 157803993
T4SS name [ID]VirB [491]
Gene symbol-
Locus tagA1E_04160
StrainRickettsia canadensis str. McKiel
Repliconchromosome [GenBank: NC_009879] [Browse all T4SS(s) in this replicon]
Location [Strand]846803..848578 [-]
Producttype IV secretion system component VirD4
Component typeVirD4
UniProt IDA8EZH4
KEGG IDrcm:A1E_04160
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.7e-164, Aligned region: 120..566
TraG-D_C [PF12696], Evalue: 1.9e-28, Aligned region: 404..526
TrwB_AAD_bind [PF10412], Evalue: 6.7e-22, Aligned region: 237..535
AAA_10 [PF12846], Evalue: 5.2e-05, Aligned region: 155..481
Protein Sequence: 591 a.a.     [Download]
>gi|157803993|ref|YP_001492542.1| type IV secretion system component VirD4 [Rickettsia canadensis str. McKiel]
MEWHKILKVTRNIFGHAIIYPVVIFCTMWISGAFVAIFTNEVGALGVDINAINIAYKWAYWLINVWWQLK
IVDYNYLKLKLLASLLGPAIIVIIFYIKNFGKIKSLQFFKQPEKVYGDASWAKPSDIEAAGLRSKKGMLI
GVDAGGYFVADGFQHALLFAPTGSGKGVGFVIPNLLFWSDSVVVHDIKLENYGLTSGWREKQGQKVFVWE
PSNPDGITHCYNPLDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADHTKTKSFGEV
VRTMRSDDVVYNLAVVLDTLGSVIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANPLIDSATATSD
FNIQEFKKVKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKIPDVKEEPYGVMFLLDEFPTLGKMDTF
KAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLSNATYRITFAANNYETANLISQLVGNKTVEQRS
FSKPLFFDLNISTRTQNVSQVQRALLLPQEVIQLPRDEQIVLIESFPPIKSRKIKYYEDKLFTSRLLPPT
FVPIQVPFDPRANNNEDSEETETTTAPENNE
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|157803189|ref|NC_009879.1|:c848578-846803 Rickettsia canadensis str. McKiel, complete genome
ATGGAATGGCATAAGATACTTAAAGTTACTAGGAATATATTTGGTCATGCTATAATTTATCCGGTTGTTA
TTTTTTGTACCATGTGGATAAGCGGTGCATTTGTTGCAATTTTTACTAATGAAGTTGGAGCTTTAGGCGT
AGATATAAATGCTATAAATATTGCTTATAAGTGGGCTTATTGGCTTATTAATGTTTGGTGGCAGTTAAAA
ATTGTCGACTATAATTATTTAAAATTAAAGCTACTCGCATCTCTTCTTGGGCCTGCTATTATTGTTATAA
TATTTTACATTAAAAATTTTGGAAAAATAAAATCATTACAATTTTTTAAGCAACCGGAAAAAGTATATGG
AGATGCTAGTTGGGCTAAACCATCAGATATAGAGGCCGCAGGTCTTAGATCTAAAAAAGGTATGTTAATA
GGTGTTGATGCCGGTGGATATTTTGTTGCCGATGGTTTCCAACATGCTTTATTATTTGCTCCTACCGGTT
CAGGTAAAGGTGTGGGTTTTGTAATACCTAACTTGTTATTTTGGAGTGATTCTGTAGTAGTACATGATAT
AAAGCTCGAAAATTACGGTTTGACGAGCGGTTGGCGTGAGAAACAAGGTCAGAAAGTTTTTGTGTGGGAG
CCTTCTAATCCCGATGGTATAACTCATTGTTACAATCCGCTTGATTGGGTTAGTACTAAGCCTGGTCAAA
TGGTTGATGACGTTCAAAAAATTTCAAACCTTATAATGCCTGAAAAGGATTTTTGGAATAATGAAGCACG
CAGTTTATTTTTAGGTGTAACTTTATATTTAATAGCTGATCATACTAAAACTAAATCTTTTGGTGAAGTA
GTGCGTACCATGAGAAGTGACGATGTAGTTTATAATCTAGCAGTCGTACTTGATACTTTAGGCAGTGTAA
TACATCCTGTTGCATATATGAATATTGCTGCGTTTCTGCAAAAAGCTGATAAAGAGCGTTCAGGTGTAAT
ATCTACAATGAACTCATCTCTTGAATTATGGGCAAATCCGTTAATCGATTCTGCTACCGCTACCTCTGAT
TTTAATATACAAGAATTTAAAAAAGTCAAAACAACTGTATATGTAGGACTTACTCCAGATAATATACAAC
GCTTGCAGAAATTAATGCAGGTATTTTATCAGCAAGCTACAGAATTTTTAAGCCGAAAAATACCCGATGT
AAAAGAAGAACCTTATGGTGTGATGTTCTTACTTGATGAGTTCCCAACTCTTGGGAAGATGGATACTTTT
AAAGCCGGTATAGCATATTTTAGAGGTTATAGAGTACGTTTATTTTTAATTATTCAAGATACGCAGCAAT
TAAAAGGAACATATGAAGATGCCGGTATGAATTCATTCTTATCTAATGCAACATACCGTATTACTTTTGC
TGCTAATAACTATGAAACAGCAAATTTAATATCGCAGCTTGTTGGTAATAAGACGGTAGAACAAAGATCA
TTTAGTAAACCTTTATTTTTTGATCTTAATATTTCTACTAGAACACAAAATGTTTCTCAAGTTCAAAGGG
CTTTACTTTTACCTCAAGAAGTAATACAGTTACCGAGAGATGAGCAAATTGTTTTAATAGAATCCTTTCC
ACCTATAAAATCTCGTAAAATTAAGTATTACGAAGATAAGTTGTTTACTAGTAGATTATTACCGCCTACT
TTTGTACCTATTCAAGTACCTTTTGATCCTAGGGCAAATAATAATGAGGATTCTGAAGAGACTGAAACAA
CAACTGCTCCGGAAAATAATGAGTAA
 Primer design