SecReT4
Protein ID: 157803994
T4SS name [ID]VirB [491]
Gene symbol-
Locus tagA1E_04165
StrainRickettsia canadensis str. McKiel
Repliconchromosome [GenBank: NC_009879] [Browse all T4SS(s) in this replicon]
Location [Strand]848751..849755 [-]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDA8EZH5
KEGG IDrcm:A1E_04165
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7e-93, Aligned region: 13..311
Protein Sequence: 334 a.a.     [Download]
>gi|157803994|ref|YP_001492543.1| type IV secretion system ATPase VirB11 [Rickettsia canadensis str. McKiel]
MNLEFAALETFLLPFKNLFAEDGINEIMVNKPGEVWVERKGDIYSQPIPELDSEHLLSLGRLIAQSTEQM
ISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYAIRKPSGMNFTLDEYAKMGAFDETATESLVDEDTVIL
NNFLAEKKIKEFIKHAVISKKNIIISGGTSTGKTTFTNAALTAIPVIERLITVEDAREVVLSRHPNRVHL
LASKGGQGRANVTTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLK
LMVMQADLGMPPEEVKKYILTVVDIIVQLKRGSSGKRYVSEVYYKKNKNAERMV
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|157803189|ref|NC_009879.1|:c849755-848751 Rickettsia canadensis str. McKiel, complete genome
ATGAATTTAGAATTTGCTGCCTTAGAGACATTTTTACTTCCTTTTAAAAATTTATTTGCTGAAGACGGTA
TTAATGAAATTATGGTTAATAAGCCTGGAGAAGTATGGGTTGAAAGGAAAGGCGATATATACTCTCAGCC
AATACCGGAACTGGATAGCGAACATCTACTTTCATTAGGACGTTTAATTGCTCAATCTACCGAACAGATG
ATTTCAGAAGAAAAGCCTTTACTTTCTGCAACTTTACCAAATGGTTACCGTATTCAAATAGTGTTTCCTC
CTGCTTGTGAAATAGGACAAATCATTTATGCTATCAGAAAGCCTAGCGGTATGAATTTCACTTTAGATGA
GTACGCTAAAATGGGGGCATTTGATGAAACTGCAACAGAGAGTTTAGTCGATGAAGATACAGTAATTTTA
AATAATTTCTTAGCTGAAAAAAAGATTAAAGAATTTATTAAACATGCAGTTATTTCAAAGAAAAATATTA
TAATTAGCGGTGGTACTTCAACCGGTAAAACTACTTTTACAAATGCGGCACTTACTGCAATACCTGTAAT
AGAAAGATTGATTACTGTAGAAGATGCTCGTGAAGTTGTACTATCAAGACATCCTAACAGAGTACATTTA
CTTGCCTCCAAAGGAGGACAGGGACGAGCAAATGTTACTACTCAAGATTTAATAGAAGCCTGTTTGCGTT
TAAGACCTGATAGAATTATAGTTGGTGAGCTTCGAGGTAAAGAAGCTTTTAGTTTTTTGCGTGCTATTAA
TACCGGTCATCCCGGTTCAATATCGACACTGCATGCTGATAGTCCTGCTATGGCAATTGAGCAGTTAAAG
CTTATGGTTATGCAAGCTGATCTCGGTATGCCGCCTGAAGAAGTAAAGAAGTATATTTTAACCGTTGTAG
ATATCATTGTGCAGTTAAAACGTGGTAGCAGCGGGAAAAGATATGTTTCGGAAGTATATTATAAGAAGAA
CAAAAATGCTGAAAGAATGGTGTAA
 Primer design