SecReT4
Protein ID: 157803997
T4SS name [ID]VirB [491]
Gene symbol-
Locus tagA1E_04180
StrainRickettsia canadensis str. McKiel
Repliconchromosome [GenBank: NC_009879] [Browse all T4SS(s) in this replicon]
Location [Strand]851806..852534 [-]
Producthypothetical protein
Component typeVirB8
UniProt IDA8EZH8
KEGG IDrcm:A1E_04180
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.7e-44, Aligned region: 36..240
Protein Sequence: 242 a.a.     [Download]
>gi|157803997|ref|YP_001492546.1| hypothetical protein A1E_04180 [Rickettsia canadensis str. McKiel]
MNNIFGFFKSSNNSQRVGDTQNQESIKSANPLKITQNWYEERSDKLIVQRNLLIILIIILTIFMVISTLV
IAFVVKSKQFDPFVIQLNSNTGRASVVEPMSSPVLTADESLTRYFIKKYITARETYNPVDFTTLARTTIR
LLSTSSVYYNYLSYIRNKDFDPILKYKEDNTTFLVIKSWSKIAADKYIVRFSVNETSGNQLVYNKIAVVS
YAYVPMQLTDSELDINPVGFQVNGYRVDDDNS
 
Nucleotide Sequence: 729 bp     [Download]
>gi|157803189|ref|NC_009879.1|:c852534-851806 Rickettsia canadensis str. McKiel, complete genome
ATGAATAATATATTTGGTTTCTTTAAATCAAGTAATAACTCGCAACGTGTTGGAGATACACAAAATCAAG
AAAGTATTAAATCGGCTAATCCTTTAAAAATTACTCAGAATTGGTATGAAGAGCGATCTGATAAGTTAAT
TGTTCAACGTAACTTACTTATCATATTAATAATAATACTAACCATTTTTATGGTTATATCAACTTTAGTA
ATAGCATTTGTAGTAAAATCTAAACAGTTTGATCCTTTTGTTATTCAGCTTAATAGTAATACCGGACGTG
CCTCGGTGGTAGAACCTATGTCATCACCGGTATTAACAGCAGATGAGTCTCTTACAAGGTATTTTATCAA
GAAATATATAACGGCACGAGAAACATATAATCCGGTTGATTTTACTACTTTAGCTCGTACAACAATAAGA
TTATTGTCAACAAGCAGTGTTTATTATAATTATCTTAGCTATATAAGAAATAAAGATTTTGATCCTATTT
TAAAATATAAAGAAGATAATACTACATTTTTAGTAATAAAATCATGGTCAAAAATCGCAGCAGATAAATA
TATAGTTAGATTTTCCGTAAATGAAACATCAGGAAACCAATTAGTTTATAATAAAATAGCAGTAGTAAGT
TATGCTTATGTACCTATGCAATTAACAGATTCAGAACTTGATATAAATCCGGTAGGATTCCAAGTTAACG
GATATAGGGTAGATGATGACAATAGTTAG
 Primer design