SecReT4
Protein ID: 157803998
T4SS name [ID]VirB [491]
Gene symbol-
Locus tagA1E_04185
StrainRickettsia canadensis str. McKiel
Repliconchromosome [GenBank: NC_009879] [Browse all T4SS(s) in this replicon]
Location [Strand]853281..853979 [+]
Producthypothetical protein
Component typeVirB8
UniProt IDA8EZH9
KEGG IDrcm:A1E_04185
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.4e-18, Aligned region: 21..199
Protein Sequence: 232 a.a.     [Download]
>gi|157803998|ref|YP_001492547.1| hypothetical protein A1E_04185 [Rickettsia canadensis str. McKiel]
MDPLTNAIQEYIKSGEYFIDARQWYNFKYILPLSHRSLLLLICTVFTLLLILICININILLPINEKVSYL
IKDDAEQQATITNTKHSSLVNPYIAVANIMLQNYVKQREEYNYDTLKEQFIFIKNTSTSIVYMQFANLMN
IDNPLSPVIRYQKLYKRSINILSINNINDNKAVVTFESLAKNSTGEILENMLWESRIGFIMDAIGINISP
DTAFNFTITSYKLKLLRNINQK
 
Nucleotide Sequence: 699 bp     [Download]
>gi|157803189|ref|NC_009879.1|:853281-853979 Rickettsia canadensis str. McKiel, complete genome
ATGGACCCATTAACCAACGCAATACAAGAATATATCAAATCTGGTGAATATTTTATTGATGCAAGACAAT
GGTATAATTTTAAGTATATCTTACCGTTAAGTCATAGAAGTCTTCTACTTTTAATATGCACGGTTTTTAC
CTTATTATTGATCTTAATTTGTATAAATATCAATATATTGCTACCAATAAACGAAAAAGTAAGTTATTTA
ATAAAAGATGATGCCGAGCAACAAGCTACCATTACTAATACTAAACATTCATCATTAGTAAACCCTTATA
TTGCCGTTGCAAATATTATGCTTCAGAATTATGTAAAACAACGAGAAGAATATAATTATGATACATTAAA
AGAACAATTTATCTTTATCAAAAATACTTCTACGAGTATTGTTTATATGCAATTTGCTAATCTTATGAAT
ATAGATAACCCATTATCACCGGTCATAAGATATCAAAAATTATATAAACGCTCAATTAATATATTATCAA
TTAACAATATAAATGATAATAAGGCAGTTGTTACTTTTGAATCATTGGCAAAGAACAGTACAGGTGAAAT
CTTAGAAAATATGCTGTGGGAATCAAGGATAGGGTTTATAATGGATGCTATAGGTATAAATATATCGCCA
GATACAGCGTTTAATTTTACCATTACTAGTTATAAGCTAAAATTATTAAGGAATATAAATCAGAAATAA
 Primer design