SecReT4
Protein ID: 157825508
T4SS name [ID]VirB [490]
Gene symbol-
Locus tagA1C_02045
StrainRickettsia akari str. Hartford
Repliconchromosome [GenBank: NC_009881] [Browse all T4SS(s) in this replicon]
Location [Strand]383048..383746 [-]
ProductVirB8 protein
Component typeVirB8
UniProt IDA8GMU5
KEGG IDrak:A1C_02045
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.5e-18, Aligned region: 21..222
Protein Sequence: 232 a.a.     [Download]
>gi|157825508|ref|YP_001493228.1| VirB8 protein [Rickettsia akari str. Hartford]
MDPLTNAIQEYIKSGEYFIDARKWYNFKYILPLSHRSLLILICTLFTLLLILICININILLPINKKVSYL
IKDDAEKHATVTNTKHSTLANPYISVANIMLQNYVKQREEYNYDILKEQFTFIKNASTSIVYMQFANFMN
IDNSLSPVIRYQKLYRRSINVLSINNINDTEAVVTFESLAQNSTGEILENMVWEARIGFIMDSISASTSP
DMPFNFTVTSYKLKLLRNKNQK
 
Nucleotide Sequence: 699 bp     [Download]
>gi|157825125|ref|NC_009881.1|:c383746-383048 Rickettsia akari str. Hartford chromosome, complete genome
ATGGACCCATTAACCAACGCAATACAAGAATATATAAAATCCGGCGAATATTTTATTGATGCAAGAAAAT
GGTATAATTTTAAGTATATCTTACCATTAAGTCATAGAAGTCTTCTGATTTTAATATGCACGCTTTTTAC
CTTATTATTAATCTTAATTTGTATAAATATTAACATATTGTTACCAATAAATAAAAAAGTAAGTTATTTA
ATAAAAGATGATGCCGAAAAACACGCTACCGTTACTAATACTAAACATTCAACACTCGCCAATCCTTATA
TTTCTGTCGCAAATATTATGCTTCAGAATTATGTAAAACAACGAGAAGAATACAATTACGATATATTAAA
AGAACAATTTACCTTTATCAAAAATGCTTCTACGAGTATTGTTTATATGCAATTTGCTAATTTTATGAAT
ATTGATAACTCATTATCACCGGTCATAAGATATCAAAAATTATATAGACGCTCAATTAATGTATTATCAA
TTAACAATATAAACGATACCGAGGCAGTTGTTACTTTTGAATCATTGGCCCAAAATAGTACGGGTGAAAT
TTTAGAAAATATGGTATGGGAAGCAAGAATCGGATTTATAATGGATTCTATCAGTGCAAGTACATCACCT
GATATGCCATTCAATTTTACCGTTACTAGTTACAAGCTAAAGTTATTAAGGAATAAAAATCAGAAATAA
 Primer design