SecReT4
Protein ID: 157825510
T4SS name [ID]VirB [490]
Gene symbol-
Locus tagA1C_02055
StrainRickettsia akari str. Hartford
Repliconchromosome [GenBank: NC_009881] [Browse all T4SS(s) in this replicon]
Location [Strand]384440..385171 [+]
ProductVirB8 protein
Component typeVirB8
UniProt IDA8GMU7
KEGG IDrak:A1C_02055
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.1e-42, Aligned region: 37..241
Protein Sequence: 243 a.a.     [Download]
>gi|157825510|ref|YP_001493230.1| VirB8 protein [Rickettsia akari str. Hartford]
MNNIFGFFKSSNNSKSGSGDTQNQESIKSANPLKITQNWYEERSDKLMVQRNLLIILVILLTIFMVVATL
VIAFVVKSKQFDPFVIQLNSNTGHASVVEPISSPVLTADESLTRYFIKKYITARETYNPVDFTTIARTII
RLFSTSGVYYNYLGYIRNKDFDPTIKYKEDNTTFLVIKSWSKIAADKYIVRFSVNETSGSQLVYNKIAVV
SYAYVPMQLTDSELDINPVGFQVNGYRVDDDNS
 
Nucleotide Sequence: 732 bp     [Download]
>gi|157825125|ref|NC_009881.1|:384440-385171 Rickettsia akari str. Hartford chromosome, complete genome
ATGAATAATATATTTGGCTTCTTTAAATCAAGTAACAACTCGAAAAGCGGTTCAGGAGATACACAAAATC
AAGAAAGTATTAAATCGGCTAATCCTTTAAAAATTACTCAGAATTGGTATGAAGAGCGATCTGATAAGTT
AATGGTTCAACGTAACTTACTTATCATATTAGTAATACTACTAACCATTTTTATGGTTGTGGCAACTTTA
GTAATAGCATTTGTAGTAAAATCTAAACAGTTTGACCCTTTTGTTATTCAGCTTAATAGTAATACGGGGC
ATGCTTCGGTGGTAGAACCTATTTCATCGCCGGTATTAACGGCGGATGAGTCTCTTACAAGGTATTTTAT
AAAGAAATACATAACGGCGCGGGAAACATATAATCCGGTTGATTTTACGACGATAGCGCGTACGATAATA
AGATTATTTTCAACAAGTGGTGTTTATTATAATTATCTTGGCTATATAAGAAATAAAGATTTTGATCCTA
CGATAAAATATAAAGAAGATAACACTACATTTTTAGTAATAAAATCATGGTCAAAAATCGCAGCAGATAA
ATATATAGTTAGATTTTCTGTAAATGAAACATCAGGAAGCCAATTAGTTTATAATAAAATAGCGGTAGTA
AGTTATGCTTATGTGCCTATGCAATTAACAGATTCAGAACTTGACATAAATCCGGTAGGGTTTCAAGTTA
ACGGATATAGGGTAGACGATGACAATAGTTAG
 Primer design