SecReT4
Protein ID: 157825513
T4SS name [ID]VirB [490]
Gene symbol-
Locus tagA1C_02070
StrainRickettsia akari str. Hartford
Repliconchromosome [GenBank: NC_009881] [Browse all T4SS(s) in this replicon]
Location [Strand]387230..388234 [+]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDA8GMV0
KEGG IDrak:A1C_02070
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 8.8e-93, Aligned region: 13..311
Protein Sequence: 334 a.a.     [Download]
>gi|157825513|ref|YP_001493233.1| type IV secretion system ATPase VirB11 [Rickettsia akari str. Hartford]
MNEEFAALETFLLPFKNLFAEDGINEIMVNKPGEVWVEKKGDIYSKQIPELDSEHLLSLGRLVAQSTEQM
ISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYSIRKPSGMTLTLDEYAKMGVFDDTATESLVDEDVVML
NNFLAEKKIKEFIRYAVVSKKNIIISGGTSTGKTTFTNTALTEIPARERLITVEDAREVVLSSHPNRVHL
LASKGGQGRANVTTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLK
LMVMQADLGMPPEEVKKYILTVVDIVVQLKRGSDGKRYVSEVYYKNNKNAEGMV
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|157825125|ref|NC_009881.1|:387230-388234 Rickettsia akari str. Hartford chromosome, complete genome
ATGAATGAAGAATTTGCAGCTTTAGAGACGTTTTTACTTCCTTTTAAAAATTTATTTGCTGAAGACGGTA
TTAACGAGATTATGGTTAATAAGCCTGGAGAAGTATGGGTTGAAAAAAAAGGCGATATATATTCTAAGCA
AATACCGGAATTGGATAGTGAGCATCTACTTTCATTAGGGCGTTTAGTTGCTCAATCTACCGAACAGATG
ATTTCGGAAGAAAAGCCTTTACTTTCTGCAACTTTGCCTAACGGTTACCGTATTCAAATAGTATTTCCTC
CTGCTTGTGAGATAGGACAAATCATTTATTCTATAAGAAAGCCTAGCGGTATGACTCTAACTTTAGATGA
GTACGCTAAAATGGGGGTATTTGATGATACTGCAACAGAGAGTTTAGTAGATGAAGATGTAGTAATGTTA
AATAATTTCTTAGCTGAAAAAAAGATTAAAGAATTTATTAGATATGCAGTTGTTTCAAAGAAAAATATCA
TAATTAGTGGTGGTACTTCAACCGGTAAAACTACTTTTACTAATACAGCACTTACTGAAATACCTGCAAG
AGAAAGATTAATTACTGTAGAAGATGCTCGTGAGGTTGTGCTATCAAGCCATCCTAACAGAGTGCATTTA
CTTGCTTCCAAAGGAGGACAGGGGCGTGCAAATGTTACTACTCAAGATTTAATAGAGGCATGTTTGCGTT
TAAGACCGGATAGAATTATAGTAGGTGAGCTTCGAGGTAAGGAAGCTTTTAGTTTTTTGCGTGCTATTAA
TACAGGTCATCCCGGTTCAATATCAACACTGCATGCCGATAGCCCTGCTATGGCTATTGAGCAGTTAAAG
CTTATGGTTATGCAAGCAGATCTTGGTATGCCGCCTGAAGAAGTAAAGAAGTATATTTTAACCGTTGTAG
ATATAGTTGTGCAGTTAAAACGCGGTAGCGATGGGAAAAGATATGTTTCGGAAGTGTATTATAAGAATAA
TAAGAACGCTGAAGGTATGGTGTAG
 Primer design