SecReT4
Protein ID: 157825514
T4SS name [ID]VirB [490]
Gene symbol-
Locus tagA1C_02075
StrainRickettsia akari str. Hartford
Repliconchromosome [GenBank: NC_009881] [Browse all T4SS(s) in this replicon]
Location [Strand]388397..390172 [+]
Producttype IV secretion system protein VirB8
Component typeVirD4
UniProt IDA8GMV1
KEGG IDrak:A1C_02075
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.4e-166, Aligned region: 120..567
TraG-D_C [PF12696], Evalue: 2e-28, Aligned region: 404..526
TrwB_AAD_bind [PF10412], Evalue: 8.5e-22, Aligned region: 237..535
AAA_10 [PF12846], Evalue: 2.5e-05, Aligned region: 155..481
Protein Sequence: 591 a.a.     [Download]
>gi|157825514|ref|YP_001493234.1| type IV secretion system protein VirB8 [Rickettsia akari str. Hartford]
MEWHKILKVTRNIFGHAIIHPVVIFCTIWLSGAFVAIFTNEVGALGGDINAINIAYKWAYWLINVWGQLK
IADYNYLKLKLLASLLGPAIVVIIFYIKNFARIKSLQFFEQPEKVYGDASWANPSDIEAAGLRSKKGMLI
GVDAGGYFVADGFQHALLFAPTGSGKGVGFVIPNLLFWSDSVVVHDIKLENHGLTSGWREKQGQKVFVWE
PSNPDGITHCYNPIDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADPTKTKSFGEV
VRTMRSDDVVYNLAVVLDTLGGVIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANPLIDSATASSD
FNIQEFKKVKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPNLKEEPYGVMFLLDEFPTLGKMDTF
KAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLSNATYRITFAANNYETANLISQLVGNKTVEQRS
FSKPLFFDLNISTRTQNVSQVQRALLLPQEVIQLPRDEQIVLIESFPPIKSRKIKYYEDKFFTSRLLPPT
FVPTQVPFDPRANNNEASEETEITTAPENNE
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|157825125|ref|NC_009881.1|:388397-390172 Rickettsia akari str. Hartford chromosome, complete genome
ATGGAATGGCATAAGATACTTAAAGTTACTAGAAATATATTTGGTCATGCTATAATTCATCCGGTTGTTA
TTTTTTGTACCATTTGGCTAAGTGGTGCATTTGTTGCAATTTTTACTAATGAGGTTGGAGCTTTAGGTGG
AGATATAAATGCTATAAATATTGCTTATAAGTGGGCTTACTGGCTTATTAACGTTTGGGGGCAGTTAAAA
ATTGCCGACTATAATTATTTAAAATTGAAGCTACTTGCATCTCTTCTTGGTCCCGCTATTGTTGTAATAA
TATTTTACATTAAAAATTTTGCACGAATAAAATCATTACAATTTTTTGAGCAACCGGAAAAAGTATATGG
AGATGCTAGCTGGGCTAATCCGTCAGATATAGAGGCTGCTGGTCTTAGATCCAAAAAAGGTATGTTAATA
GGTGTAGATGCCGGTGGATATTTTGTTGCAGATGGGTTCCAGCATGCTTTATTATTTGCTCCTACAGGTT
CAGGTAAAGGTGTGGGTTTTGTGATACCTAACCTGTTATTTTGGAGTGATTCAGTAGTAGTACATGACAT
AAAGCTCGAAAATCACGGTTTGACGAGCGGTTGGCGTGAAAAACAAGGTCAGAAAGTTTTTGTTTGGGAG
CCTTCTAATCCCGACGGTATTACGCATTGTTATAATCCGATTGATTGGGTTAGTACTAAGCCCGGGCAGA
TGGTTGATGACGTTCAAAAAATTTCAAATCTTATAATGCCGGAAAAGGATTTTTGGAATAATGAAGCACG
AAGTTTATTCTTAGGTGTAACTTTATATTTAATAGCTGATCCTACTAAAACTAAATCTTTCGGTGAAGTA
GTGCGTACCATGAGAAGTGATGACGTAGTTTATAATCTAGCGGTCGTACTCGATACGCTTGGCGGTGTAA
TACATCCTGTTGCATATATGAATATTGCTGCGTTTTTGCAAAAAGCTGATAAAGAGCGTTCGGGCGTAAT
ATCTACAATGAACTCATCGCTTGAATTATGGGCAAACCCGCTTATTGATTCGGCTACTGCATCTTCTGAT
TTCAACATACAAGAATTTAAAAAAGTAAAAACAACCGTATATGTAGGATTAACACCCGATAATATACAGC
GTTTGCAAAAATTAATGCAGGTGTTTTATCAGCAGGCGACAGAATTTTTAAGCCGTAAAATGCCGAATTT
AAAGGAAGAGCCGTATGGTGTAATGTTCTTACTTGATGAGTTCCCGACGCTTGGAAAGATGGATACTTTT
AAAGCCGGTATAGCTTATTTTAGAGGTTATAGAGTTCGGTTATTCTTGATTATTCAAGATACGCAGCAGT
TAAAAGGCACATATGAAGATGCAGGGATGAATTCCTTCTTATCTAATGCAACATACCGTATTACTTTTGC
TGCTAATAACTATGAAACGGCAAATTTAATATCGCAGCTTGTCGGTAATAAGACGGTAGAACAAAGATCA
TTTAGTAAACCTTTATTTTTTGACCTTAATATTTCTACTAGAACCCAAAACGTTTCTCAAGTTCAAAGAG
CTTTACTTTTACCTCAAGAAGTAATACAGTTACCTAGAGATGAGCAAATTGTTTTAATAGAATCCTTTCC
GCCTATAAAATCTCGTAAAATTAAGTATTACGAAGATAAATTTTTTACTAGTAGATTATTACCACCGACT
TTTGTACCTACTCAAGTACCTTTTGATCCTAGGGCAAATAATAATGAGGCTTCTGAAGAGACTGAAATAA
CAACTGCTCCGGAAAATAATGAGTAA
 Primer design