SecReT4
Protein ID: 157826806
T4SS name [ID]VirB [488]
Gene symbol-
Locus tagA1I_02285
StrainRickettsia bellii OSU 85-389
Repliconchromosome [GenBank: NC_009883] [Browse all T4SS(s) in this replicon]
Location [Strand]423890..425668 [-]
Producttype IV secretion system protein VirB8
Component typeVirD4
UniProt IDA8GVF6
KEGG IDrbo:A1I_02285
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 6.4e-164, Aligned region: 120..567
TraG-D_C [PF12696], Evalue: 1.9e-28, Aligned region: 404..526
TrwB_AAD_bind [PF10412], Evalue: 9.1e-21, Aligned region: 237..535
AAA_10 [PF12846], Evalue: 2.2e-05, Aligned region: 155..481
Protein Sequence: 592 a.a.     [Download]
>gi|157826806|ref|YP_001495870.1| type IV secretion system protein VirB8 [Rickettsia bellii OSU 85-389]
MGWHNILKVTRNIFGHAIIHPVVIFSTLWISGAFVAIFTNEIGTLGVDVTAINIAYKWSYWLVSVWGQLK
ISDYNYLKLKLLASLLGPALVVIIFYIKNFERIKSLQFFEQPEKVYGDARWASPADVESAGLRAKKGMLI
GVDSGGYFVADGFQHALLFAPTGSGKGVGFVIPNLLFWSDSVVVHDIKLENHGLTSGWREKQGQKVFVWE
PSNPDGITHCYNPIDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADPVKTKSFGEV
VRTMRSDDVVYNLAVVLDTLGGIIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANPLIDSATASSD
FNVQEFKKIKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPDLKEEPYGVMFLLDEFPTLGKMDTF
KAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLSNSTYRITFAANNYETANLISQLVGNKTVEQRS
FSKPIFFDLNISTRTQNVSQVQRALLLPQEVIQLPRDEQIVLIESFPPIKSRKIKYFEDKFFTSRLLPPT
FVPTQVPFDPRANNNETSNETEEAAVAPENSE
 
Nucleotide Sequence: 1779 bp     [Download]
>gi|157826385|ref|NC_009883.1|:c425668-423890 Rickettsia bellii OSU 85-389 chromosome, complete genome
ATGGGATGGCATAACATACTCAAAGTCACTAGAAATATATTCGGTCATGCTATAATTCATCCGGTTGTTA
TTTTTAGTACCTTATGGATAAGTGGTGCATTTGTTGCAATCTTTACCAATGAAATTGGGACTCTTGGAGT
AGATGTAACTGCTATAAATATTGCTTACAAATGGTCTTATTGGCTTGTTAGCGTTTGGGGACAATTAAAA
ATCTCTGATTATAACTATTTAAAATTAAAGCTACTTGCTTCACTTCTTGGTCCTGCTCTTGTCGTTATAA
TATTTTACATTAAAAACTTTGAGAGAATCAAATCGCTACAATTTTTTGAGCAACCTGAAAAAGTCTATGG
TGATGCTAGGTGGGCAAGTCCTGCAGATGTTGAATCGGCTGGTCTTAGAGCTAAAAAAGGTATGCTAATC
GGGGTTGATAGTGGTGGTTATTTTGTTGCTGATGGATTCCAGCACGCCTTATTATTTGCTCCTACCGGTT
CTGGTAAAGGTGTGGGTTTTGTTATACCTAACCTATTATTTTGGTCTGATTCCGTAGTCGTTCATGATAT
AAAACTTGAAAACCATGGCTTAACGAGCGGTTGGCGTGAAAAACAAGGTCAGAAAGTCTTTGTATGGGAG
CCATCTAACCCAGATGGTATTACTCACTGCTATAATCCGATTGACTGGGTTAGTACTAAGCCTGGGCAAA
TGGTTGATGACGTACAAAAAATTTCAAACCTTATCATGCCTGAAAAGGATTTCTGGAATAACGAAGCACG
AAGCTTATTCTTGGGCGTAACTTTATATTTAATAGCTGATCCTGTTAAAACCAAATCCTTTGGTGAAGTG
GTGCGTACCATGAGAAGTGACGATGTAGTATATAATCTGGCGGTCGTGCTTGATACTTTAGGCGGAATAA
TCCACCCTGTTGCATATATGAATATTGCAGCTTTCCTACAAAAAGCCGATAAAGAGCGTTCAGGTGTTAT
ATCAACCATGAACTCATCACTTGAGTTATGGGCAAACCCATTAATTGACTCTGCTACTGCTTCTTCCGAT
TTTAATGTACAAGAATTCAAGAAAATAAAAACAACTGTATATGTAGGTCTTACTCCTGATAATATACAAC
GTTTGCAGAAATTAATGCAGGTATTTTATCAGCAAGCTACAGAGTTTTTAAGCCGAAAAATGCCTGATTT
AAAAGAAGAACCTTACGGCGTGATGTTCTTACTTGATGAGTTCCCAACACTTGGTAAGATGGATACGTTC
AAAGCAGGTATTGCTTATTTCAGGGGGTATAGAGTTCGTTTATTCTTAATTATTCAAGATACCCAGCAGC
TAAAAGGAACATATGAAGATGCGGGTATGAACTCTTTCTTATCTAACTCAACATATCGTATTACCTTTGC
TGCTAATAACTATGAAACTGCAAATTTAATATCACAATTAGTCGGTAATAAAACTGTAGAACAAAGATCA
TTCAGCAAACCTATATTTTTTGATCTTAATATTTCTACTAGAACACAAAATGTTTCTCAAGTTCAAAGGG
CTTTACTTTTACCTCAAGAAGTAATACAGTTACCAAGAGACGAGCAGATTGTTTTAATAGAGTCTTTTCC
TCCGATAAAATCTCGTAAGATTAAATATTTTGAGGATAAGTTTTTTACTAGTAGATTATTACCGCCGACT
TTTGTACCTACTCAAGTACCTTTTGATCCACGAGCAAATAATAATGAAACTTCTAATGAGACAGAAGAGG
CTGCTGTTGCTCCAGAAAACAGTGAGTAA
 Primer design