SecReT4
Protein ID: 157826807
T4SS name [ID]VirB [488]
Gene symbol-
Locus tagA1I_02290
StrainRickettsia bellii OSU 85-389
Repliconchromosome [GenBank: NC_009883] [Browse all T4SS(s) in this replicon]
Location [Strand]425801..426805 [-]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDA8GVF7
KEGG IDrbo:A1I_02290
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.7e-92, Aligned region: 13..311
Protein Sequence: 334 a.a.     [Download]
>gi|157826807|ref|YP_001495871.1| type IV secretion system ATPase VirB11 [Rickettsia bellii OSU 85-389]
MSDAFAALETFLLPFKELFAEDGINEIMVNKPGEAWVEKKGDIYSKQLPELDAEHLLSLGRLVAQSTEQM
ISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYSIRKPSGMNLTLDEYAKMGAFDETATESLVDQDEIIL
NGYLAEKKIKEFIKHAVISKKNIIISGGTSTGKTTFTNAALTEIPQLERLITVEDAREVVLSSHPNRVHL
LASKGGQGRANVTTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLK
LMVMQADLGMPPEEVKKYILTVVDIVVQLKRGSGGKRYVSEVYYKKNKNAEGMV
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|157826385|ref|NC_009883.1|:c426805-425801 Rickettsia bellii OSU 85-389 chromosome, complete genome
ATGAGTGATGCATTTGCTGCCTTAGAGACCTTTTTATTACCGTTTAAAGAATTATTTGCTGAAGATGGTA
TTAACGAGATTATGGTTAATAAACCTGGAGAGGCATGGGTTGAGAAAAAAGGTGATATATATTCTAAACA
ATTACCAGAGCTTGACGCAGAACATTTACTTTCGCTTGGACGTTTAGTTGCTCAATCTACTGAACAAATG
ATTTCAGAAGAAAAGCCTTTACTTTCAGCCACCCTTCCAAATGGTTATCGTATTCAAATAGTATTTCCAC
CTGCTTGTGAAATAGGACAAATCATTTATTCTATAAGAAAGCCGAGCGGTATGAATCTAACTCTAGATGA
ATATGCTAAAATGGGAGCTTTTGATGAAACTGCAACAGAAAGTTTAGTAGATCAAGATGAAATAATTCTA
AACGGATATTTAGCTGAAAAGAAGATAAAAGAATTCATCAAACATGCAGTTATTTCAAAGAAAAATATTA
TAATTAGCGGCGGTACTTCAACAGGTAAAACTACTTTCACTAATGCAGCACTTACTGAAATACCTCAATT
GGAAAGATTAATTACAGTAGAAGATGCTCGTGAGGTTGTATTATCTAGTCACCCTAATAGAGTTCATTTG
CTTGCTTCTAAAGGCGGGCAAGGACGAGCAAACGTTACTACTCAAGATCTAATAGAAGCGTGTTTGCGTT
TAAGACCTGATAGAATTATAGTTGGTGAGCTTCGAGGTAAAGAAGCTTTTAGTTTCTTGCGAGCTATTAA
TACTGGTCACCCAGGTTCTATATCTACACTCCACGCTGATAGTCCTGCTATGGCAATTGAACAACTAAAA
TTGATGGTTATGCAAGCTGATCTTGGTATGCCACCTGAAGAAGTAAAAAAATATATTTTAACAGTTGTAG
ATATTGTAGTACAATTAAAACGTGGCAGTGGCGGTAAAAGATATGTATCGGAAGTATATTATAAAAAGAA
TAAAAACGCCGAAGGAATGGTGTAG
 Primer design