SecReT4
Protein ID: 157826810
T4SS name [ID]VirB [488]
Gene symbol-
Locus tagA1I_02305
StrainRickettsia bellii OSU 85-389
Repliconchromosome [GenBank: NC_009883] [Browse all T4SS(s) in this replicon]
Location [Strand]428814..429533 [-]
Productvirulence protein
Component typeVirB8
UniProt IDA8GVG0
KEGG IDrbo:A1I_02305
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.8e-44, Aligned region: 33..237
Protein Sequence: 239 a.a.     [Download]
>gi|157826810|ref|YP_001495874.1| virulence protein [Rickettsia bellii OSU 85-389]
MLDNIFGFFKSSDKAQNDAKSEQNQANPLKITQNWYEERADKLIVQRNLLIILLIILLIFMIISTLVIAF
VVKSKQFDPFVIQLDDTTGRASVVEPISSPVLTADESLTRYFIKKYINARETYNFVDFTTLARTTIRLLS
TSNLFYGYLGYIRDKNNDPSLKYQENNTTYLVVKSWSKIASDKYIVRFSVNEATGNQTVYNKIAVVSYAY
VPMQLTDSELDINPVGFQVNGYRVDDDNS
 
Nucleotide Sequence: 720 bp     [Download]
>gi|157826385|ref|NC_009883.1|:c429533-428814 Rickettsia bellii OSU 85-389 chromosome, complete genome
ATGTTAGATAATATATTCGGCTTCTTTAAATCAAGTGATAAAGCACAAAATGATGCAAAGAGCGAGCAAA
ACCAAGCAAATCCGCTAAAGATAACTCAAAATTGGTATGAAGAACGTGCTGATAAGCTGATTGTTCAACG
TAACTTATTAATAATATTACTGATAATATTATTAATTTTTATGATAATATCTACTTTAGTAATAGCTTTT
GTGGTAAAATCTAAACAATTTGATCCTTTTGTCATTCAACTTGATGACACTACCGGTCGTGCATCAGTAG
TAGAGCCTATTTCATCACCAGTGCTTACTGCAGATGAGTCTCTTACAAGATATTTTATAAAAAAATATAT
AAATGCAAGAGAAACATATAATTTTGTTGATTTCACTACCTTGGCACGCACTACTATAAGATTACTTTCA
ACAAGTAATCTTTTTTATGGTTATCTTGGGTATATAAGAGATAAAAACAACGATCCAAGTTTAAAGTATC
AGGAAAATAATACGACTTATTTAGTAGTAAAGTCATGGTCAAAAATTGCCTCAGACAAATATATAGTTAG
ATTTTCCGTAAATGAAGCAACAGGAAATCAAACAGTTTATAATAAAATAGCAGTAGTAAGTTATGCTTAC
GTACCAATGCAATTAACAGATTCAGAACTTGATATAAATCCTGTAGGATTTCAAGTTAACGGATATAGGG
TAGACGATGATAATAGTTAG
 Primer design