SecReT4
Protein ID: 157827408
T4SS name [ID]Tra_F [541]
Gene symbol-
Locus tagA1I_05540
StrainRickettsia bellii OSU 85-389
Repliconchromosome [GenBank: NC_009883] [Browse all T4SS(s) in this replicon]
Location [Strand]1053993..1054544 [+]
Productconjugative transfer protein TraE
Component typeTraE_F
UniProt IDA8GX35
KEGG IDrbo:A1I_05540
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.4e-12, Aligned region: 1..174
Protein Sequence: 183 a.a.     [Download]
>gi|157827408|ref|YP_001496472.1| conjugative transfer protein TraE [Rickettsia bellii OSU 85-389]
MDHLFKQSGVQQLVKYNKRLLLITLLLAVTSLLGMIKTISTEEKWLLIPAIEPDRRMIVSSKSYHETYLK
EWAVFVMKELFTTSPEEVERQIADMKVVSSNTEQLDKFFKEHLDFVKGSGICSVFFPKKVKVIEDGVLIN
GTFRYWFSENKHIATDKTYLLTYKRGANHLLLLTGIKEEEVNK
 
Nucleotide Sequence: 552 bp     [Download]
>gi|157826385|ref|NC_009883.1|:1053993-1054544 Rickettsia bellii OSU 85-389 chromosome, complete genome
ATGGATCATTTATTTAAGCAAAGCGGGGTTCAGCAGCTAGTTAAATATAATAAGAGATTATTGCTTATTA
CATTGCTGCTTGCAGTTACGAGTCTTCTTGGGATGATTAAAACAATTAGCACGGAAGAAAAATGGTTATT
AATTCCAGCAATAGAGCCAGATCGTCGGATGATAGTATCATCCAAAAGCTATCATGAGACTTATCTTAAA
GAATGGGCAGTGTTTGTAATGAAGGAATTATTTACTACTTCGCCTGAGGAAGTAGAGAGGCAAATAGCAG
ATATGAAGGTGGTGTCTAGTAATACAGAGCAGCTGGATAAATTTTTTAAGGAACATTTAGATTTTGTTAA
GGGCTCTGGAATTTGCTCAGTATTTTTTCCTAAAAAGGTAAAAGTCATTGAGGATGGAGTATTAATTAAT
GGAACATTTCGTTATTGGTTTTCTGAGAATAAGCATATAGCAACTGATAAAACTTATTTGTTAACCTATA
AGCGAGGAGCAAATCATTTATTATTACTTACAGGAATTAAAGAAGAAGAGGTAAATAAGTAA
 Primer design