SecReT4
Protein ID: 157827411
T4SS name [ID]Tra_F [541]
Gene symbol-
Locus tagA1I_05555
StrainRickettsia bellii OSU 85-389
Repliconchromosome [GenBank: NC_009883] [Browse all T4SS(s) in this replicon]
Location [Strand]1055317..1056735 [+]
ProductF pilus assembly protein TraB
Component typeTraB_F
UniProt IDA8GX38
KEGG IDrbo:A1I_05555
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5e-37, Aligned region: 192..396
Protein Sequence: 472 a.a.     [Download]
>gi|157827411|ref|YP_001496475.1| F pilus assembly protein TraB [Rickettsia bellii OSU 85-389]
MDQEFNKQEELQSTVEDHKLPSTFSKRLSELIEIIKNRPLVTLACIGVIMVLVFYEFAENEVKTSRGLQE
DRQSREISGIEQAIDPRAKWTAEILNEVKNMQNHLEKLIENKYLETKTKIDDFSQKLESLEKPLKETILY
DGNDFNNDQKIEDLLDNNFEQSIAAAPTAPVKRLLGYVKRADVELKKDFKDYITTGSFARGVLLTGVVVG
TGTNNAASPEPIMIRLVDTAIFSKGYKTEQIKEAILIGSCSGDISSERAKCRLETVSLLNSNGEIIEKPV
EGWLIGEDGRPGIKGIVVDRSSDVARMAVLNGVLGGIAQFFQNQASNGIFPVSPITGQQNALKAADSLKA
GVYSGTGNALEKLADFAIKRAESMSPVIVVTSGRVIDVVFRKGFNLRENKEAAKVDRVLPPTTTDYSQKE
ANYSNYQNYAGNKVTSFTKAKTKLQERFTRDNDDYEMTDIDLQSEQQHPGNF
 
Nucleotide Sequence: 1419 bp     [Download]
>gi|157826385|ref|NC_009883.1|:1055317-1056735 Rickettsia bellii OSU 85-389 chromosome, complete genome
ATGGATCAAGAGTTCAATAAGCAGGAAGAATTACAAAGTACAGTAGAGGATCATAAATTACCATCTACAT
TTAGTAAAAGATTATCAGAACTCATAGAGATAATTAAAAACAGACCATTAGTAACTTTAGCTTGCATAGG
CGTGATAATGGTTTTGGTATTTTATGAATTTGCCGAAAATGAGGTCAAAACTTCCCGAGGTTTACAAGAA
GATAGACAATCAAGGGAAATATCAGGGATAGAGCAGGCAATAGATCCAAGGGCTAAATGGACTGCAGAAA
TATTAAATGAAGTCAAAAACATGCAGAATCATTTGGAAAAGCTAATAGAGAATAAATATTTAGAAACTAA
AACTAAAATTGATGATTTTAGTCAAAAGTTAGAATCATTAGAGAAGCCTCTTAAAGAAACTATATTATAT
GATGGCAATGATTTTAATAATGATCAAAAGATAGAAGATTTATTAGATAATAACTTTGAGCAAAGCATTG
CTGCTGCTCCTACTGCTCCAGTAAAAAGATTACTTGGTTACGTAAAAAGAGCTGATGTGGAACTCAAAAA
AGATTTTAAAGATTATATTACTACTGGTAGCTTTGCACGGGGGGTGCTGCTTACTGGTGTGGTGGTTGGA
ACTGGCACTAATAATGCAGCTTCGCCTGAGCCCATAATGATAAGGCTTGTTGATACAGCTATTTTTTCTA
AAGGCTATAAAACGGAGCAAATCAAAGAAGCAATTTTAATTGGTTCTTGCAGCGGGGATATATCATCGGA
GCGGGCTAAATGCCGGTTAGAGACGGTATCTTTACTAAATAGTAATGGAGAGATCATTGAAAAACCGGTA
GAAGGATGGTTAATAGGAGAAGATGGTAGACCTGGAATTAAAGGGATAGTTGTTGATAGATCATCAGATG
TAGCAAGGATGGCGGTGCTTAACGGCGTACTTGGCGGGATAGCACAATTTTTTCAGAACCAGGCAAGCAA
TGGCATATTTCCGGTGTCACCGATTACCGGTCAGCAAAATGCCTTAAAAGCTGCTGACTCTCTTAAAGCC
GGTGTTTATTCCGGTACCGGTAATGCTTTAGAAAAGCTTGCTGATTTTGCAATTAAACGAGCAGAAAGTA
TGAGTCCGGTAATTGTTGTCACTTCAGGTAGAGTAATAGATGTTGTATTTAGAAAAGGTTTTAATTTAAG
AGAGAATAAAGAAGCTGCTAAAGTAGATAGAGTACTACCACCAACTACTACTGATTATTCGCAAAAGGAA
GCAAATTATAGTAATTATCAAAATTATGCCGGGAATAAAGTGACAAGTTTTACTAAGGCAAAAACTAAAT
TGCAAGAACGTTTTACTCGGGATAATGATGATTATGAGATGACGGATATTGATTTGCAGTCAGAACAACA
ACATCCGGGTAATTTTTAA
 Primer design