SecReT4
Protein ID: 157827412
T4SS name [ID]Tra_F [541]
Gene symbol-
Locus tagA1I_05560
StrainRickettsia bellii OSU 85-389
Repliconchromosome [GenBank: NC_009883] [Browse all T4SS(s) in this replicon]
Location [Strand]1056735..1056989 [+]
Productconjugative transfer protein TraV
Component typeTraV_F
UniProt IDA8GX39
KEGG IDrbo:A1I_05560
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 84 a.a.     [Download]
>gi|157827412|ref|YP_001496476.1| conjugative transfer protein TraV [Rickettsia bellii OSU 85-389]
MNNKIINLLLLSMLSFSVANCKLMPYRSDFDCPLPQGLKCKALYEVNKMADQNMFNPNNNNDKPNFKSIC
STRCFGRYNNDIRN
 
Nucleotide Sequence: 255 bp     [Download]
>gi|157826385|ref|NC_009883.1|:1056735-1056989 Rickettsia bellii OSU 85-389 chromosome, complete genome
ATGAATAATAAAATAATTAATCTGCTTTTGTTATCGATGTTAAGCTTTAGCGTTGCTAATTGTAAGTTGA
TGCCATATAGAAGCGATTTTGATTGCCCGCTGCCCCAAGGACTAAAATGTAAAGCTTTATATGAAGTAAA
TAAAATGGCTGATCAGAATATGTTTAATCCAAATAATAATAATGACAAGCCTAATTTTAAATCGATATGC
TCTACTAGATGCTTTGGAAGGTATAATAATGATATCAGGAATTGA
 Primer design