SecReT4
Protein ID: 157827413
T4SS name [ID]Tra_F [541]
Gene symbol-
Locus tagA1I_05565
StrainRickettsia bellii OSU 85-389
Repliconchromosome [GenBank: NC_009883] [Browse all T4SS(s) in this replicon]
Location [Strand]1056973..1059504 [+]
Productconjugative transfer protein TraC
Component typeTraC_F
UniProt IDA8GX40
KEGG IDrbo:A1I_05565
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.3e-53, Aligned region: 462..749
TraC_F_IV [PF11130], Evalue: 1e-37, Aligned region: 11..218
FtsK_SpoIIIE [PF01580], Evalue: 1.9e-05, Aligned region: 459..499
Protein Sequence: 843 a.a.     [Download]
>gi|157827413|ref|YP_001496477.1| conjugative transfer protein TraC [Rickettsia bellii OSU 85-389]
MISGIDKDFARERLAKHFVYESYDEESSLFFNRASVGFVLLGWPLVGTSLQAQGEIAEFLKSDENLPAGS
SFQILMIGSDHIREYLDNWQLHRKGTIFAELSSRRTKFLEQKAKAEGNIKDVVLLISVTIPTLTIDINEM
IRRREVLQDTFKSIGLATYNVEATLLLKFVRLIFGWREEEHPELNPYEILSEQILPGNFSLYEKEDYVSL
NDNQIFISLEAGKRPAEWLLSAMDLFLGNELRRDEYIRSNFLIHFGLQIVPNQVIAKTAAITKREALERN
INAGMGKFFPNLASEAQDLAGAVACLQSGDRVVNIHLNVIMWDKKNKAKGAASQFCSQLRRSGWYFVPCK
YDHLAVVLASLPMQLVEAAPNSLVGKFNRFNNIFNKKTRGVGIALSNLGRGIKTIASESKVLLPIIGEWK
GDLSSPGMLLTGRRGQIMYWSPFGSALIGSNLYSTAATPNENFNLCIAGVPGSGKSVFMQELMLSVLGTG
GKVFVLDYGRSFKRTCLLLGGNYIEFDVKNPISINPFSEIPADGSEGSIEAQADFLASFPSILATMAAPQ
YGTNDLQQPMLQKALIAVWQEKGNKVEITDIADWLLKREESYAQELGNMLFPFTRDGQYGKFFSGKAKLS
LNADIVVIETDHLRSSPALLAVIVQIMIVHINQSMVKGDRKRPFLIMIDEAWKLLSGKRSGEFIEEAGRI
ARKYNGSITLATQQLTDYFREEGSAAEKAFENSSHKVILKQNPESFKAMRASPKLAGFVDEDWKLNLLQS
IHSNPPHYSEAAIYGPSVNGVVARLMLDPFTLMLTSTNARDYQAIEDRMIAGMSVTDAINNILDERVFFV
NTG
 
Nucleotide Sequence: 2532 bp     [Download]
>gi|157826385|ref|NC_009883.1|:1056973-1059504 Rickettsia bellii OSU 85-389 chromosome, complete genome
ATGATATCAGGAATTGATAAAGATTTTGCTCGGGAAAGACTAGCTAAACATTTTGTTTATGAATCATATG
ATGAGGAGAGTAGCTTGTTTTTTAATAGAGCTTCAGTAGGATTTGTCCTGCTTGGCTGGCCACTGGTTGG
GACAAGCTTGCAAGCTCAAGGAGAGATAGCTGAATTTTTAAAAAGTGATGAGAATTTACCGGCAGGAAGT
AGTTTTCAAATATTGATGATTGGCTCTGATCATATAAGAGAATATCTAGATAACTGGCAATTACATAGAA
AAGGGACAATTTTTGCTGAGCTTAGTAGTAGAAGAACAAAATTTTTAGAGCAAAAAGCAAAGGCAGAGGG
GAATATCAAAGATGTCGTGTTATTAATTTCCGTAACTATTCCGACGCTGACGATTGATATTAATGAGATG
ATACGAAGAAGAGAAGTATTGCAAGATACATTTAAATCAATTGGGCTTGCTACTTACAATGTTGAGGCAA
CATTGCTATTAAAATTTGTCCGTTTAATATTTGGTTGGAGGGAAGAAGAACATCCTGAACTTAATCCTTA
TGAAATATTATCTGAGCAGATTTTACCTGGTAATTTTTCTTTATATGAAAAGGAAGATTATGTAAGTCTT
AATGATAATCAAATATTTATAAGCTTAGAGGCAGGAAAAAGACCGGCAGAGTGGCTTTTATCAGCCATGG
ATTTGTTTTTAGGTAATGAGCTAAGACGAGATGAATATATTAGATCAAATTTTCTGATTCATTTTGGTTT
GCAAATAGTGCCTAATCAAGTGATAGCAAAAACAGCAGCAATTACTAAAAGAGAAGCTTTAGAGAGAAAT
ATTAATGCTGGGATGGGTAAATTCTTTCCTAACTTAGCTAGTGAAGCACAAGATTTAGCAGGAGCAGTAG
CGTGCTTGCAAAGTGGCGATAGAGTAGTAAATATCCACTTAAATGTCATTATGTGGGATAAGAAGAACAA
AGCCAAAGGGGCAGCATCACAGTTTTGCTCACAGCTTCGTCGAAGTGGTTGGTATTTTGTCCCTTGTAAA
TATGATCATTTAGCGGTGGTACTTGCTAGTTTACCGATGCAGTTAGTTGAAGCAGCACCTAATTCTTTAG
TGGGTAAATTTAATAGATTCAATAACATATTTAATAAAAAGACTCGGGGAGTTGGCATAGCATTATCAAA
TCTTGGTAGAGGCATAAAAACTATTGCTTCAGAAAGTAAGGTGTTACTTCCTATTATTGGTGAATGGAAA
GGGGATTTAAGCTCTCCTGGAATGCTGCTTACTGGTAGAAGAGGACAGATAATGTATTGGTCTCCCTTTG
GCTCAGCATTAATTGGCTCAAATTTATATAGCACAGCTGCAACTCCAAATGAAAATTTTAATCTTTGTAT
AGCAGGAGTGCCAGGCTCTGGTAAGTCAGTGTTTATGCAAGAACTAATGCTATCGGTCTTAGGCACTGGC
GGCAAAGTGTTTGTTCTTGATTATGGTAGATCATTTAAAAGAACCTGTTTGCTACTGGGCGGTAATTATA
TTGAATTTGATGTAAAAAATCCTATTTCTATTAATCCATTTTCAGAAATTCCAGCAGACGGCAGCGAAGG
CTCAATTGAAGCACAGGCAGATTTTTTAGCAAGTTTTCCATCGATTCTAGCTACTATGGCAGCTCCGCAA
TATGGAACTAATGATTTGCAACAACCAATGCTGCAAAAGGCGTTAATAGCTGTGTGGCAAGAAAAAGGCA
ATAAAGTTGAGATAACTGACATAGCAGATTGGTTGCTTAAAAGAGAAGAATCTTACGCACAGGAACTTGG
TAATATGTTATTTCCGTTCACCAGAGATGGACAATATGGCAAGTTTTTTAGTGGTAAGGCAAAATTATCC
TTAAACGCAGATATAGTAGTAATTGAAACTGATCATCTTCGTAGTAGCCCGGCACTACTTGCAGTAATTG
TACAAATCATGATTGTTCATATTAACCAGAGCATGGTTAAAGGTGATAGGAAGCGTCCTTTTCTAATCAT
GATTGATGAAGCATGGAAATTACTATCTGGCAAAAGATCTGGAGAATTTATTGAAGAAGCAGGAAGAATT
GCAAGAAAATATAACGGCTCAATTACTCTTGCTACTCAGCAATTAACTGATTACTTTAGAGAGGAAGGAT
CAGCAGCTGAAAAAGCTTTTGAGAACTCATCACATAAAGTTATTTTAAAGCAAAATCCTGAGAGCTTTAA
AGCAATGAGAGCAAGCCCTAAGCTTGCAGGTTTTGTCGATGAGGACTGGAAGCTAAATTTACTACAATCA
ATTCATTCAAACCCGCCGCATTATAGTGAAGCAGCGATTTATGGACCAAGTGTTAACGGAGTTGTAGCAA
GGTTAATGTTAGACCCATTTACTCTGATGCTAACATCTACTAATGCTAGGGATTACCAAGCCATAGAAGA
TAGAATGATCGCAGGAATGAGCGTTACAGATGCCATCAATAATATACTGGATGAGAGAGTTTTTTTTGTC
AATACCGGCTGA
 Primer design