SecReT4
Protein ID: 157827414
T4SS name [ID]Tra_F [541]
Gene symbol-
Locus tagA1I_05570
StrainRickettsia bellii OSU 85-389
Repliconchromosome [GenBank: NC_009883] [Browse all T4SS(s) in this replicon]
Location [Strand]1059757..1060440 [+]
Productconjugative transfer protein TraW
Component typeTraW_F
UniProt IDA8GX41
KEGG IDrbo:A1I_05570
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 227 a.a.     [Download]
>gi|157827414|ref|YP_001496478.1| conjugative transfer protein TraW [Rickettsia bellii OSU 85-389]
MTGYLDLKIIIISSFVLFVIMLKVSYVNAHNNNLAISIDNNSKIEIRDYEVQGHVFPIIEESLLEVIMAK
LQIAKQNGVLEKMQEEFKNKVQQKISRPTPVLALAKASINRNWHYDPSFIQKTDVKDQAGNIIVKVGTNV
NPLEKISWGKALIFIDGDDEQQVKWAKSKIGKLVLTSGNPIKLAQKLNKPVFFDQGGVLTTRFKIKAVPA
IARQEGKLLKISEIKIN
 
Nucleotide Sequence: 684 bp     [Download]
>gi|157826385|ref|NC_009883.1|:1059757-1060440 Rickettsia bellii OSU 85-389 chromosome, complete genome
ATGACAGGGTATTTAGATCTAAAAATTATTATTATAAGTTCCTTTGTTTTATTTGTTATTATGTTGAAGG
TAAGTTATGTAAATGCACACAATAATAATTTGGCTATAAGCATAGATAATAATTCTAAAATAGAAATTAG
AGATTATGAAGTCCAAGGTCATGTATTTCCAATTATTGAAGAGTCATTACTAGAGGTCATTATGGCTAAA
CTTCAAATAGCAAAACAAAATGGCGTTTTAGAGAAAATGCAGGAAGAATTTAAAAATAAGGTACAGCAAA
AAATATCAAGACCAACTCCGGTATTGGCTCTAGCAAAAGCAAGCATAAACCGAAATTGGCACTATGATCC
GAGCTTTATACAAAAGACAGATGTAAAAGATCAAGCAGGAAACATCATAGTAAAAGTTGGCACAAATGTA
AATCCTTTGGAGAAAATAAGCTGGGGAAAAGCTTTAATATTTATTGATGGTGATGATGAGCAGCAAGTTA
AGTGGGCTAAATCAAAAATAGGAAAATTAGTACTCACGAGTGGCAATCCTATTAAGCTAGCACAAAAGTT
AAATAAGCCAGTGTTTTTTGATCAAGGTGGCGTGCTTACTACTCGTTTTAAAATAAAAGCAGTACCGGCT
ATTGCCCGGCAGGAAGGTAAATTACTTAAAATTAGCGAAATCAAGATTAATTAA
 Primer design