SecReT4
Protein ID: 157827416
T4SS name [ID]Tra_F [541]
Gene symbol-
Locus tagA1I_05580
StrainRickettsia bellii OSU 85-389
Repliconchromosome [GenBank: NC_009883] [Browse all T4SS(s) in this replicon]
Location [Strand]1060727..1061683 [+]
Productconjugal transfer protein TraU
Component typeTraU_F
UniProt IDA8GX43
KEGG IDrbo:A1I_05580
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 5.2e-75, Aligned region: 21..316
Protein Sequence: 318 a.a.     [Download]
>gi|157827416|ref|YP_001496480.1| conjugal transfer protein TraU [Rickettsia bellii OSU 85-389]
MFIIIILLGNYSYASIGCVGRFVNPITDICWKCLFPITIGGVKVVPSPMADTNNPRQIICFCPKAGIPMP
IPGIPIGFWEPVRLVDVTKSPMCMVSLGGINLGTSMQKGVKDDIEGSSFYHVHWYIYPVIYWLEILLDFA
CLEMSQVDVAYLTEFDLLWGDDAKSAILNPESLLFGNIAAQSACIADCMSSSSGSLSNDGMFWCSGCQGS
LYPFTGTTSSYNGGVGTSALIVAKFMAKLHRELLLWGYMGREGLCGKYPMPIIKKCQYRLQMTYPITEIH
SCKKIGETETTWQGAREFPVKGEDFGYLIWRKRSCCLF
 
Nucleotide Sequence: 957 bp     [Download]
>gi|157826385|ref|NC_009883.1|:1060727-1061683 Rickettsia bellii OSU 85-389 chromosome, complete genome
ATGTTTATTATAATTATTTTGCTTGGTAATTATAGTTATGCATCGATTGGCTGCGTAGGAAGATTTGTAA
ATCCAATAACTGATATTTGCTGGAAATGTTTATTTCCAATTACTATCGGAGGAGTAAAAGTAGTGCCAAG
CCCTATGGCTGATACTAATAACCCAAGGCAAATAATTTGTTTTTGCCCTAAAGCCGGCATTCCTATGCCA
ATTCCTGGTATTCCAATTGGATTCTGGGAACCGGTAAGACTTGTTGATGTAACGAAATCTCCTATGTGTA
TGGTAAGCCTTGGTGGTATTAACCTTGGTACTAGCATGCAAAAAGGAGTTAAGGATGATATAGAGGGAAG
TAGCTTTTATCATGTACATTGGTATATATATCCGGTTATTTACTGGCTTGAGATATTACTTGATTTTGCT
TGTTTAGAGATGTCACAAGTTGACGTAGCATATTTAACTGAATTTGATCTGTTATGGGGAGATGATGCTA
AATCTGCAATATTAAATCCTGAGAGTTTATTATTTGGCAATATTGCAGCTCAAAGTGCATGTATAGCTGA
TTGCATGAGCTCTAGTTCTGGTAGTCTTTCTAATGATGGGATGTTTTGGTGTTCAGGCTGTCAAGGTTCT
CTTTATCCCTTTACCGGTACAACTAGCTCTTATAATGGCGGAGTTGGAACTTCTGCATTAATAGTAGCTA
AATTTATGGCTAAGTTACATAGAGAATTATTACTCTGGGGCTATATGGGAAGAGAAGGATTATGTGGTAA
ATATCCAATGCCAATAATCAAAAAGTGCCAATATAGACTGCAGATGACTTATCCTATAACGGAAATTCAT
TCTTGTAAAAAGATTGGTGAGACTGAAACTACCTGGCAGGGTGCACGCGAATTCCCAGTTAAAGGTGAGG
ATTTTGGTTATTTGATTTGGCGTAAACGCAGTTGCTGTCTCTTTTGA
 Primer design