SecReT4
Protein ID: 157827417
T4SS name [ID]Tra_F [541]
Gene symbol-
Locus tagA1I_05585
StrainRickettsia bellii OSU 85-389
Repliconchromosome [GenBank: NC_009883] [Browse all T4SS(s) in this replicon]
Location [Strand]1061728..1062162 [+]
Productconjugative transfer protein TrbC
Component typeTrbC_F
UniProt IDA8GX44
KEGG IDrbo:A1I_05585
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 9.5e-25, Aligned region: 46..139
Protein Sequence: 144 a.a.     [Download]
>gi|157827417|ref|YP_001496481.1| conjugative transfer protein TrbC [Rickettsia bellii OSU 85-389]
MQFNLKAIILTCLLILGGTSSLAQPEVLLHNILQPKLEPNTYNNIYIFVSFSMPDSALKSYYIEAEQEGA
RLVMRGLKNNSFLETKAKANEIGISFDIDPNLFEKYQITSVPIVVIDNNQGKVKKLAGHIGLNDALQIMQ
EEQM
 
Nucleotide Sequence: 435 bp     [Download]
>gi|157826385|ref|NC_009883.1|:1061728-1062162 Rickettsia bellii OSU 85-389 chromosome, complete genome
ATGCAATTTAACTTAAAGGCAATAATTTTAACTTGTTTACTAATATTAGGTGGAACAAGTTCTTTGGCAC
AACCAGAAGTATTATTACATAATATACTACAACCTAAATTAGAGCCTAACACATATAATAATATCTATAT
TTTTGTTTCATTTTCAATGCCTGATTCAGCATTAAAGAGTTATTATATTGAAGCAGAACAAGAAGGAGCA
AGACTTGTAATGCGAGGTCTAAAAAATAATTCTTTTTTAGAAACTAAAGCAAAAGCTAATGAAATTGGTA
TTAGCTTTGATATTGATCCAAATCTATTTGAGAAATATCAAATTACTTCTGTACCGATAGTAGTGATAGA
TAATAACCAAGGCAAAGTTAAAAAACTAGCAGGTCATATAGGATTAAATGATGCATTGCAGATAATGCAA
GAGGAACAAATGTGA
 Primer design