SecReT4
Protein ID: 157827418
T4SS name [ID]Tra_F [541]
Gene symbol-
Locus tagA1I_05590
StrainRickettsia bellii OSU 85-389
Repliconchromosome [GenBank: NC_009883] [Browse all T4SS(s) in this replicon]
Location [Strand]1062159..1063970 [+]
Productconjugative transfer protein TraN
Component typeTraN_F
UniProt IDA8GX45
KEGG IDrbo:A1I_05590
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 8e-72, Aligned region: 300..543
Protein Sequence: 603 a.a.     [Download]
>gi|157827418|ref|YP_001496482.1| conjugative transfer protein TraN [Rickettsia bellii OSU 85-389]
MRQSINIIMLVTLVMNAISSYSATMEDSYNSARQYEHSIKLGNPDQIGNKIIFDKEVNISNLSKMNDQDL
TNQGSVMLNNSAQGQLLQQSELKKINAMQEYDLNPNNPVISNSAKIEAEPLRHTEGTALNVSEKVIKTKI
NKSCCEGVEFEIDVIRNLILDAELIDKWGDWQDKAIAFSGLEISNSYRHWLYPVFWKKKRRLGKRKTIYS
MHMHNNQIIMEEVRAAIVAKLNTSLDHIDTYIGISPQGEGALTEAWDGDIVKWDRYVFTYKYRDKIKVFR
EKGEYFQIVNELSEALVEENECHEINRICLEAGNKLFFNQYNVNRPCWSEQIKYQCSSEPKYGCDHLKKQ
GCELARSNCIRQAASICLQWHKDYICSNEKKELSSSIAGSQMFCLGGNRHTATIVPNTDMGSVGYLAMLN
EMKKDMQTNPISVFKGHANSCRKTNIGNFLNCCSGFKGWGKDLGLSRCNAEEKALALKRAKGQCNYVGTY
CAKKDKIFKTCITKKSTYCCFNSKLARVFQEQGKKQLAISFGTGQQANCRGFTVEELQRIDFSKFDLEEL
FSDLLDHAKSKINKNFPQQLKNQMPIMQQQKFNNNHTDSNLSY
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|157826385|ref|NC_009883.1|:1062159-1063970 Rickettsia bellii OSU 85-389 chromosome, complete genome
GTGAGACAAAGTATTAATATTATTATGTTAGTTACTTTAGTGATGAATGCGATCAGTTCTTACTCTGCTA
CTATGGAGGATAGTTATAATAGTGCCAGACAGTATGAACACAGTATTAAGCTTGGTAATCCTGATCAAAT
AGGCAATAAGATAATATTTGATAAAGAGGTAAATATATCAAATTTAAGTAAAATGAATGATCAAGACTTA
ACAAATCAAGGTAGTGTTATGTTAAATAACTCTGCACAAGGGCAATTACTGCAACAAAGTGAGCTGAAGA
AAATAAATGCAATGCAAGAATATGACCTTAATCCTAACAATCCCGTAATTAGTAATTCAGCTAAGATTGA
GGCAGAGCCATTAAGGCATACAGAAGGGACTGCACTTAATGTTAGTGAAAAAGTAATTAAAACCAAAATT
AATAAGAGTTGCTGTGAAGGGGTAGAATTTGAAATAGATGTTATCAGGAATCTTATACTAGATGCTGAAT
TAATAGATAAATGGGGTGATTGGCAAGATAAAGCAATAGCATTTTCAGGTCTTGAGATAAGTAACAGTTA
TCGTCACTGGCTTTATCCTGTCTTTTGGAAGAAGAAAAGACGTTTAGGTAAGCGTAAAACAATATACAGC
ATGCATATGCATAATAATCAGATCATAATGGAAGAAGTGAGAGCAGCTATTGTTGCTAAGTTAAATACTT
CCCTTGATCATATTGATACATATATCGGCATTTCTCCTCAAGGAGAAGGAGCATTAACTGAAGCCTGGGA
TGGTGATATAGTAAAATGGGATAGATATGTTTTTACTTATAAATATCGTGATAAGATTAAAGTATTTAGA
GAAAAAGGTGAGTACTTCCAAATAGTAAATGAGCTTTCAGAAGCTTTAGTTGAGGAAAATGAATGCCATG
AAATAAATCGCATATGTCTTGAAGCTGGTAATAAGTTGTTTTTTAATCAATATAATGTTAATCGTCCATG
CTGGAGCGAGCAAATTAAATATCAATGTAGTAGTGAGCCAAAATATGGGTGTGATCATTTAAAGAAGCAA
GGTTGTGAACTTGCAAGGAGCAATTGCATTAGGCAAGCTGCTAGTATCTGTTTGCAATGGCACAAAGATT
ACATATGCTCTAATGAGAAAAAAGAGCTTAGCTCCTCTATAGCAGGATCACAAATGTTTTGTTTAGGAGG
GAATCGTCATACTGCAACTATTGTGCCAAATACTGATATGGGGAGTGTTGGGTATCTTGCAATGTTAAAT
GAAATGAAAAAAGATATGCAGACAAATCCGATTTCAGTATTTAAAGGTCATGCCAACAGTTGCCGCAAAA
CAAATATTGGCAATTTTCTTAATTGTTGCTCTGGATTCAAAGGTTGGGGTAAGGATTTAGGGCTGAGCCG
GTGTAATGCAGAAGAAAAAGCCTTAGCCTTAAAAAGGGCAAAAGGTCAGTGTAACTATGTTGGGACATAT
TGTGCTAAGAAAGATAAAATATTTAAGACATGTATTACTAAAAAATCTACTTATTGTTGTTTTAATTCAA
AACTTGCAAGAGTTTTTCAAGAGCAAGGAAAAAAACAATTAGCTATTAGTTTTGGCACAGGGCAGCAGGC
TAATTGTCGTGGGTTTACAGTAGAAGAGCTGCAAAGAATAGATTTTTCTAAATTTGATTTAGAGGAGCTA
TTTAGTGATTTACTTGATCATGCTAAAAGTAAAATAAATAAGAACTTTCCGCAGCAACTAAAAAACCAGA
TGCCTATAATGCAACAACAAAAATTTAATAATAATCATACTGATTCAAATTTATCCTATTAA
 Primer design