SecReT4
Protein ID: 157827419
T4SS name [ID]Tra_F [541]
Gene symbol-
Locus tagA1I_05595
StrainRickettsia bellii OSU 85-389
Repliconchromosome [GenBank: NC_009883] [Browse all T4SS(s) in this replicon]
Location [Strand]1064041..1064874 [+]
ProductF pilus assembly protein TraF
Component typeTraF_F
UniProt IDA8GX46
KEGG IDrbo:A1I_05595
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.1e-59, Aligned region: 45..261
Protein Sequence: 277 a.a.     [Download]
>gi|157827419|ref|YP_001496483.1| F pilus assembly protein TraF [Rickettsia bellii OSU 85-389]
MLLINDWSNHAFAGTIDLNANSINKMIGLDLASNNEVKDSTQPKGFLWYNEDHAYKPEILKFSQDQKKQE
PELELYDQRIEALKKEFNRAKRKALDDPTLENVIIAQRLHKQILEKSYKFATMWQLATLLDYSLTNENIP
ANSLHKKLYEIRQDKDSSQKLRFLAKNWGLILQVNQGCNYCQAFIPIVREFADKYGFQLIFVSNSETRFQ
GIPTIKDTGLLQTLNPAKLVPVLYLIDSSGIQIYPVARGIISEDKIAENILLVIQHYNRLKVNDYDQ
 
Nucleotide Sequence: 834 bp     [Download]
>gi|157826385|ref|NC_009883.1|:1064041-1064874 Rickettsia bellii OSU 85-389 chromosome, complete genome
TTGTTACTAATCAATGATTGGTCAAATCACGCATTTGCTGGTACTATAGACTTAAATGCTAATAGTATAA
ATAAAATGATAGGATTAGATTTAGCAAGCAACAATGAAGTAAAAGATAGCACTCAACCAAAAGGTTTTCT
TTGGTATAATGAGGATCATGCTTACAAGCCAGAAATATTAAAATTTTCTCAAGATCAAAAAAAGCAAGAG
CCAGAACTTGAGCTTTATGATCAAAGGATAGAAGCTTTAAAGAAGGAATTTAATAGAGCTAAGCGTAAAG
CCTTAGATGATCCTACTCTTGAAAATGTCATTATTGCTCAAAGGTTACACAAACAAATTTTAGAAAAATC
ATATAAATTTGCTACCATGTGGCAGCTTGCTACCTTACTTGATTATAGTCTTACAAACGAGAATATACCT
GCAAATTCATTGCATAAAAAATTATACGAGATAAGACAAGATAAAGACAGCAGCCAAAAACTAAGATTTT
TAGCTAAGAATTGGGGATTAATTCTGCAAGTAAATCAAGGATGTAATTACTGCCAGGCATTTATCCCTAT
TGTAAGAGAATTTGCAGATAAATATGGCTTTCAATTAATTTTTGTAAGTAATAGTGAAACTAGATTTCAA
GGGATACCAACCATTAAAGATACTGGTTTGTTACAAACACTAAATCCTGCAAAGCTTGTACCGGTATTAT
ATTTAATCGATAGCAGCGGCATACAAATATATCCAGTTGCAAGAGGAATTATTAGTGAAGATAAAATTGC
TGAAAATATTTTATTGGTAATTCAGCACTATAATAGACTAAAGGTTAATGATTATGATCAGTAA
 Primer design