SecReT4
Protein ID: 157827420
T4SS name [ID]Tra_F [541]
Gene symbol-
Locus tagA1I_05600
StrainRickettsia bellii OSU 85-389
Repliconchromosome [GenBank: NC_009883] [Browse all T4SS(s) in this replicon]
Location [Strand]1064864..1066198 [+]
ProductF pilus assembly protein TraH
Component typeTraH_F
UniProt IDA8GX47
KEGG IDrbo:A1I_05600
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 7.8e-86, Aligned region: 36..377
Protein Sequence: 444 a.a.     [Download]
>gi|157827420|ref|YP_001496484.1| F pilus assembly protein TraH [Rickettsia bellii OSU 85-389]
MISNNKFRRVIYIKHVMHILMIILLLQTTTTYAWDLQDVFQGMSVNVTKPGSYQSQAAGYYYAAGGLSIR
TNKTSFNPISITPPSLNMSCSGIDSYLGSFSIISGEELVQLMKNIGTQAKAYAFSLGLKTFAPQIENALK
DLRNLAMEMNQFAKGDCEMTKAIFASILPKDSAMRESVCRDLQSSSGFDYFAAGKKCRSDLEQKQALANI
QNQDPELMLTNYNIFIKAAEKAGIPENMRSAIMSMTGTIIVRDNNVYFLESLAQDEKSWIAHLKGGESAS
IYTCDNSNCLNPDLRRNITIVLDQSYQGKAKTKLDELKSKLTSNNEFSNADISFLSSIGEAFPIYDYITL
EAISGVTILDSSSELVASYSLLQHLKEVTSEVRKAVTMLKSKQVADHHLTAYLKALDRVQLFAQEKWSNM
LTSSDQIDRRARLIEQHLIAKERA
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|157826385|ref|NC_009883.1|:1064864-1066198 Rickettsia bellii OSU 85-389 chromosome, complete genome
ATGATCAGTAACAATAAGTTTAGAAGAGTAATCTACATAAAGCATGTGATGCATATTCTCATGATAATTT
TATTGTTACAAACAACAACAACTTATGCTTGGGATTTACAGGATGTATTTCAAGGCATGAGCGTTAATGT
CACTAAACCTGGTTCATATCAATCCCAAGCTGCCGGCTATTATTATGCAGCAGGAGGGTTATCTATTAGA
ACTAATAAAACATCTTTTAATCCGATTTCTATTACCCCTCCCTCGTTAAACATGAGCTGTAGTGGTATAG
ATTCTTATCTTGGTAGTTTTTCGATTATTTCAGGTGAAGAGCTAGTTCAGCTAATGAAAAATATTGGTAC
GCAAGCAAAAGCTTATGCATTTTCATTGGGTCTTAAAACTTTTGCTCCACAAATAGAAAATGCCTTAAAA
GATTTAAGAAATCTTGCTATGGAAATGAATCAATTTGCTAAGGGCGATTGTGAAATGACTAAAGCTATTT
TCGCTTCCATTTTGCCTAAAGATTCAGCCATGAGAGAATCAGTTTGCAGAGATTTACAATCCAGCTCTGG
CTTTGATTATTTTGCTGCCGGCAAAAAATGTCGTAGTGATTTAGAGCAGAAACAAGCTTTAGCGAATATC
CAAAATCAAGATCCAGAATTAATGCTGACAAATTATAATATTTTTATCAAGGCAGCAGAAAAAGCAGGAA
TCCCTGAAAATATGAGAAGTGCCATCATGTCCATGACTGGAACTATAATAGTTCGAGATAATAATGTATA
TTTCCTTGAGTCACTTGCTCAAGATGAAAAGAGCTGGATTGCTCATTTAAAAGGCGGAGAATCTGCCTCA
ATTTATACTTGTGATAATAGTAATTGTTTAAACCCAGATCTAAGACGTAATATTACTATTGTTCTAGATC
AATCATATCAAGGCAAGGCTAAAACAAAACTAGATGAATTAAAGAGCAAACTTACAAGTAATAACGAGTT
TAGTAATGCAGACATATCTTTCCTATCTTCAATAGGGGAAGCATTTCCAATATATGATTATATTACTTTA
GAAGCAATATCAGGAGTTACTATTTTAGATAGTTCTTCAGAATTAGTTGCTAGTTACAGTTTACTGCAGC
ATTTAAAGGAAGTAACCTCAGAGGTAAGAAAAGCAGTTACTATGCTCAAATCAAAGCAAGTAGCAGATCA
TCATTTAACCGCTTACTTAAAAGCTTTAGATAGAGTGCAACTTTTTGCTCAAGAAAAATGGAGTAATATG
CTAACAAGTAGTGATCAGATTGATAGAAGAGCAAGATTAATAGAACAACATTTAATCGCTAAAGAGAGGG
CTTAA
 Primer design