SecReT4
Protein ID: 157827421
T4SS name [ID]Tra_F [541]
Gene symbol-
Locus tagA1I_05605
StrainRickettsia bellii OSU 85-389
Repliconchromosome [GenBank: NC_009883] [Browse all T4SS(s) in this replicon]
Location [Strand]1066276..1068993 [+]
Productconjugative transfer protein TraG
Component typeTraG_F
UniProt IDA8GX48
KEGG IDrbo:A1I_05605
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 4e-103, Aligned region: 6..462
Protein Sequence: 905 a.a.     [Download]
>gi|157827421|ref|YP_001496485.1| conjugative transfer protein TraG [Rickettsia bellii OSU 85-389]
MTDYVIHTFGGGDILWQVFNGIGRVFASNSEYFTPVGKFALTIGGIWAATRAIFRGNIGIFAMEWFFPSL
FIFIFLFAPKANVWLKDEISMQAPVKIDNIPVGIAFFASISSKISYSLSETLEKHLLPPDEGLSSRKNGI
MFGAKAIGKIKDIQIEDPVTLTNTKEFLRQCFMKPYIIGNILGKKAEAQRASDIIAFIEQNMPNNFGIYY
KDPSNSAISFKTCRQVTPLIKAAINKELNDRLLTKFANGIGISSDRQEILSSRLKTMTSDTLKYLKKEQT
DIHQWMRQAMLLNANREAYDDLREKFSLSRIYPQLVSMNATRGLFQQSFSYLIAGEMAANIMPILQSVFF
ALVICLIFVVFPMSMLPGGYTIFKTWITLIIWVTSWPVFFTVIHCLGMISLAGKGTSHFTGLNILSQGSF
SEILLHEFATFQMLAASVPMLSWAVLKACAHATTTLANQFSPVPVASNIGANIADNNLAMDNYSIGNRTI
AQQNLTPTLQLAGGIIDDGGMRVTSTDSGRQVLTQAVDSLVNNYRSSKLLQDSYQSQFMSSQSYLDSLND
RYSNLTTTGNSMATEIGKRLSYEEAKSIGITDSQYLALQQMNSDSIAATDHTGSSNRKGTSTSANIGLNV
PSIGGVTVRADNDQGKERGKSVNQQQSYNEALSKIKSATKDGRLGHTNSDLQSLSNNLNSNFSEQQSVGQ
EITRTKQNIEQLSYNMNYIAQNSASIDRNLNESVLNSIIAKNIPGVSSKEQAAMWASTHQQEAEQIALDI
AKINNIIPQDLSSVSSINIPSKENLRSSFDKNTKQLNDQAAISNIDDRRNDVYDKNVEQMLIQSIDNNEI
EKVKILEQLSDKVKDKKAQIEDEFNKTPESTIVRTGQQIADNLEISSKAIKKRNIKLPGHKNENN
 
Nucleotide Sequence: 2718 bp     [Download]
>gi|157826385|ref|NC_009883.1|:1066276-1068993 Rickettsia bellii OSU 85-389 chromosome, complete genome
ATGACAGATTACGTAATACATACATTTGGTGGAGGAGATATATTATGGCAAGTTTTTAATGGCATAGGAA
GAGTCTTTGCCTCAAATAGTGAGTATTTTACACCAGTAGGTAAATTTGCTTTGACAATTGGTGGAATTTG
GGCAGCAACTCGTGCTATTTTTAGAGGTAATATTGGTATTTTTGCTATGGAATGGTTTTTTCCATCCTTA
TTTATTTTTATCTTTTTATTTGCTCCAAAAGCAAATGTGTGGCTTAAAGATGAAATATCAATGCAGGCTC
CTGTAAAAATTGATAATATCCCAGTAGGTATTGCTTTTTTTGCTTCTATATCATCAAAAATAAGTTACTC
TTTATCAGAGACGCTCGAAAAGCATTTACTTCCACCTGATGAAGGGTTATCAAGCAGGAAGAATGGGATT
ATGTTTGGAGCAAAAGCTATTGGTAAAATCAAGGACATTCAAATAGAGGATCCGGTAACTTTGACCAATA
CAAAAGAATTTTTAAGACAATGTTTTATGAAACCTTATATAATTGGTAATATTTTAGGTAAAAAAGCAGA
AGCACAAAGAGCAAGTGACATCATTGCTTTTATCGAACAAAATATGCCCAATAATTTTGGTATTTATTAT
AAGGATCCAAGTAATTCTGCTATTTCTTTTAAAACCTGCAGGCAAGTAACTCCCTTGATTAAGGCAGCTA
TTAATAAAGAATTAAATGATAGGTTATTAACTAAATTTGCAAATGGTATAGGCATTAGCTCTGATAGGCA
AGAGATATTATCTAGCAGATTAAAAACTATGACCTCTGATACTCTAAAATATCTTAAAAAAGAACAAACA
GATATTCATCAGTGGATGAGACAAGCAATGCTACTTAATGCTAATCGTGAAGCTTATGATGATTTAAGAG
AAAAATTCTCACTTTCTAGAATATATCCTCAATTAGTTAGTATGAATGCGACCCGCGGGTTATTTCAGCA
ATCCTTTTCTTACCTGATTGCAGGAGAGATGGCAGCAAATATCATGCCTATCTTACAATCAGTATTTTTT
GCTTTGGTAATTTGTCTCATTTTCGTAGTATTTCCAATGTCAATGTTGCCCGGTGGTTATACTATCTTTA
AAACTTGGATAACATTAATCATTTGGGTAACCAGCTGGCCAGTATTTTTTACTGTGATTCATTGTTTAGG
GATGATTAGCCTAGCTGGTAAAGGCACAAGTCACTTTACTGGTTTAAATATCTTATCGCAAGGGAGTTTT
TCAGAAATTCTGTTGCATGAGTTTGCAACATTTCAGATGTTAGCAGCTTCAGTTCCGATGTTATCCTGGG
CAGTATTAAAGGCTTGTGCTCATGCAACTACTACTTTGGCCAATCAATTTTCTCCAGTACCGGTTGCAAG
TAATATTGGTGCTAATATTGCTGATAATAACCTTGCTATGGATAATTATAGCATCGGTAATCGAACAATT
GCCCAGCAAAATCTTACCCCAACTTTACAATTGGCAGGAGGAATTATTGATGATGGAGGAATGAGAGTAA
CCAGTACTGATAGTGGTAGACAAGTACTGACTCAAGCAGTAGACTCACTTGTTAATAACTACCGCTCTTC
TAAATTATTACAGGATAGTTATCAATCTCAGTTTATGAGCTCACAAAGTTATCTTGACTCATTAAATGAT
AGATATAGTAATTTAACTACTACAGGTAATTCTATGGCAACTGAGATAGGAAAAAGATTAAGCTATGAAG
AAGCAAAATCTATAGGTATTACTGATAGCCAGTATCTAGCCTTGCAGCAGATGAATTCAGATAGCATCGC
TGCTACTGATCATACTGGTAGCAGTAATAGAAAGGGAACTAGTACTAGTGCAAATATAGGTTTAAATGTA
CCTAGCATAGGAGGAGTAACAGTTCGAGCAGATAATGATCAAGGAAAAGAACGAGGAAAATCAGTAAATC
AACAGCAATCATATAATGAAGCATTATCTAAGATTAAAAGTGCTACTAAAGATGGCAGATTAGGTCATAC
AAATAGTGATCTGCAATCACTTAGTAATAATCTTAATAGTAACTTCTCTGAGCAACAATCTGTAGGGCAA
GAAATAACTAGAACTAAACAAAATATCGAGCAATTAAGCTATAACATGAACTATATAGCACAAAATTCTG
CCTCTATTGATCGTAATTTAAATGAATCAGTATTAAATAGCATAATTGCCAAAAATATTCCTGGAGTAAG
TAGCAAAGAGCAGGCTGCTATGTGGGCAAGTACTCACCAACAAGAAGCCGAACAAATCGCTTTAGATATA
GCTAAAATCAATAATATTATACCGCAAGACTTAAGTTCTGTAAGTAGCATCAATATTCCATCTAAAGAAA
ACTTGCGATCAAGTTTTGATAAAAATACTAAACAGTTGAATGACCAAGCTGCTATTAGTAATATTGATGA
TAGAAGAAATGATGTTTATGATAAAAATGTAGAACAAATGCTAATTCAGAGTATAGATAATAATGAAATA
GAAAAAGTAAAGATTCTTGAGCAGTTATCTGATAAAGTAAAAGATAAGAAGGCACAAATTGAAGATGAAT
TTAATAAAACTCCTGAATCAACGATTGTCAGAACTGGCCAGCAAATAGCAGATAATCTTGAAATAAGTAG
CAAAGCGATCAAGAAAAGAAATATTAAATTACCAGGCCATAAAAATGAAAATAATTGA
 Primer design