SecReT4
Protein ID: 157827423
T4SS name [ID]Tra_F [541]
Gene symbol-
Locus tagA1I_05615
StrainRickettsia bellii OSU 85-389
Repliconchromosome [GenBank: NC_009883] [Browse all T4SS(s) in this replicon]
Location [Strand]1070178..1071866 [+]
Productconjugative transfer protein TraD
Component typeTraD_F
UniProt IDA8GX50
KEGG IDrbo:A1I_05615
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.2e-134, Aligned region: 180..558
TraD_N [PF12615], Evalue: 2.4e-26, Aligned region: 27..136
TraG-D_C [PF12696], Evalue: 1.9e-20, Aligned region: 418..539
T4SS-DNA_transf [PF02534], Evalue: 6e-19, Aligned region: 313..554
AAA_10 [PF12846], Evalue: 2.6e-12, Aligned region: 194..234
AAA_10 [PF12846], Evalue: 2.6e-12, Aligned region: 399..489
DUF87 [PF01935], Evalue: 9.5e-07, Aligned region: 193..251
T2SE [PF00437], Evalue: 2.1e-06, Aligned region: 190..227
Protein Sequence: 562 a.a.     [Download]
>gi|157827423|ref|YP_001496487.1| conjugative transfer protein TraD [Rickettsia bellii OSU 85-389]
MQQNQNNFTRGSQIFAHQMRMLGQGSINALTIGLIFTVVWLMWRTYQKLSLVSLYYFIIERYAQLKLAIG
EYFYPISQIGIKFYYLEQKAWVYRNAEEFVHKFWHVTPHSHNINQFGQFLLHSAWPEGIIVFTISMFTAI
IFFMYRGKKAVIQDKIRGADLVEAKTLARMLHKNKQAANICFSGLPLVKNSERRHILITGTTGSGKTNML
NELLPQIRKEQGRAIIVDLTGSFTDRFFDPKCDKLLNPLQENTEHWLPWNDCHEIWDYNDMASNFSNYNP
KLDDFFAKSAELVLAEGLRLYQDSKDIKKLINTILYANNKEFAKSFKNSAVSGIISSSAPETSSGIQATV
SKNIEVLQHLKPKGEFSIRKWFTADKGWLFITSTPNQRVMLRPLIAAWISIAIKALMNRNINNTHSNMWF
VIDELPALQKISSLPIALAESRKYGGCVVAGMQNIHQLEEIYGSAGTASMLDLFGSKFIFRVSDQQTAHK
SALMLGEQEIIETQENLSYGANSMRDGVNMHSLEKRKLLVMPSEIMNLEDLTCYVKLAGNIPITKLQMNL
QT
 
Nucleotide Sequence: 1689 bp     [Download]
>gi|157826385|ref|NC_009883.1|:1070178-1071866 Rickettsia bellii OSU 85-389 chromosome, complete genome
ATGCAACAAAATCAAAATAATTTTACTCGTGGTTCACAGATTTTTGCTCATCAGATGAGAATGCTTGGGC
AAGGCAGTATTAATGCTTTAACTATTGGATTAATATTTACTGTAGTTTGGCTAATGTGGCGTACATATCA
GAAATTGTCCTTAGTAAGCTTATATTATTTTATCATAGAGCGATACGCACAATTAAAACTTGCCATAGGA
GAGTATTTTTACCCTATAAGCCAAATAGGTATTAAATTCTATTATTTAGAACAAAAAGCTTGGGTTTATC
GTAATGCTGAAGAATTTGTGCATAAATTTTGGCATGTTACACCGCATTCGCATAATATCAATCAATTTGG
GCAATTCTTATTGCATTCAGCTTGGCCAGAAGGTATTATTGTTTTTACTATTAGCATGTTTACTGCCATC
ATCTTTTTTATGTATCGAGGTAAAAAAGCTGTTATACAAGATAAGATCAGGGGAGCAGATTTGGTGGAAG
CAAAAACTTTAGCGAGAATGCTTCATAAAAACAAACAAGCTGCTAATATTTGTTTTTCTGGATTGCCATT
AGTTAAAAATAGCGAAAGGAGGCATATTCTTATTACCGGTACTACTGGTAGTGGTAAAACTAATATGTTA
AATGAGCTATTACCTCAGATTAGAAAAGAGCAAGGTAGAGCAATTATTGTTGATTTAACAGGTAGCTTTA
CTGATCGATTTTTTGATCCCAAATGTGATAAGCTACTTAATCCTTTGCAAGAGAATACAGAGCATTGGTT
GCCTTGGAATGATTGTCATGAAATTTGGGATTATAATGATATGGCAAGTAACTTTAGTAACTATAATCCC
AAATTAGATGATTTTTTTGCTAAAAGTGCTGAGTTGGTACTCGCTGAAGGATTAAGATTATATCAGGATA
GTAAAGACATCAAAAAGCTAATAAATACTATTCTTTATGCAAATAATAAAGAATTTGCAAAAAGTTTTAA
AAATAGTGCAGTATCTGGTATAATTAGCAGTAGTGCCCCTGAGACTTCTTCAGGTATTCAAGCAACTGTT
AGTAAAAATATTGAAGTGTTGCAACATTTAAAGCCTAAAGGTGAGTTTAGTATTAGAAAGTGGTTTACTG
CGGACAAAGGTTGGTTATTTATAACTAGTACTCCTAATCAAAGAGTAATGCTTCGACCACTTATTGCTGC
ATGGATTAGCATAGCGATAAAAGCATTAATGAATAGGAACATCAATAATACTCATAGTAATATGTGGTTT
GTGATTGATGAGCTGCCAGCTTTACAAAAGATATCTTCACTCCCTATAGCTTTGGCTGAAAGCAGGAAAT
ATGGTGGCTGCGTTGTTGCAGGTATGCAAAACATTCATCAATTAGAGGAGATATATGGTTCTGCTGGAAC
AGCTTCAATGCTTGATTTATTTGGTAGCAAATTTATTTTTCGGGTAAGTGATCAACAAACAGCACATAAA
TCAGCTTTAATGCTTGGTGAGCAAGAAATTATTGAAACTCAAGAGAATCTCTCTTATGGTGCTAACTCCA
TGCGTGATGGAGTAAATATGCATAGCTTAGAGAAAAGAAAATTATTAGTAATGCCATCTGAAATTATGAA
TCTAGAAGATCTTACCTGTTATGTAAAACTTGCGGGTAACATCCCAATTACTAAATTACAAATGAATTTA
CAAACTTGA
 Primer design