SecReT4
Protein ID: 157827425
T4SS name [ID]Tra_F [541]
Gene symbol-
Locus tagA1I_05625
StrainRickettsia bellii OSU 85-389
Repliconchromosome [GenBank: NC_009883] [Browse all T4SS(s) in this replicon]
Location [Strand]1073490..1077641 [-]
Productconjugal transfer protein TraA
Component typeTraI_F
UniProt IDA8GX52
KEGG IDrbo:A1I_05625
PDB IDNA
Domain hit(s) vs Pfam AAA_30 [PF13604], Evalue: 6.7e-47, Aligned region: 344..529
MobA_MobL [PF03389], Evalue: 4.7e-28, Aligned region: 19..209
Toprim_3 [PF13362], Evalue: 9.1e-21, Aligned region: 1101..1195
Viral_helicase1 [PF01443], Evalue: 5.7e-10, Aligned region: 365..480
UvrD_C_2 [PF13538], Evalue: 3.5e-09, Aligned region: 601..690
AAA_19 [PF13245], Evalue: 2.2e-05, Aligned region: 360..406
Protein Sequence: 1383 a.a.     [Download]
>gi|157827425|ref|YP_001496489.1| conjugal transfer protein TraA [Rickettsia bellii OSU 85-389]
MAIQFARIEIVSRSSGGNACLKAAYNARLIIKDERTNVTYNFSKKGDNVYHAVLLPNYVDKRFKDPRVLM
NEVERLETRKNSQLLKDIVIALPDDKELDLNDRIAITHEIIEEMGWVKNGLGVQIDIHQPHDGDKNWHAH
LLVTTRRFTEDGKSLGAKAVDLNPKFAKVKGKAFIIPEEEIIHKRVKEVINKYFAKLGLEIQVDPISFMP
QQHVGPTRMRSIINEIAEQNKICKLAHLEIIKNSDGVLNRIIRHQAIFTKLDIEKAIKEIPEEVEKSKLI
REVLNSDRLVKLYNEDGTDTKYYTTKDIRDEELRLLRIAYKVNNQIHFNNIIKLKSAIDNLASVNEAQRE
SLQHILINNQGIRILQGRAGTGKSQVLVQAYKIATNHGQNIIGLSPTHKAASELKSKGYRQCYTVKGFLF
KLYNGKADLPRNSLLVVDEAGMVGNSDYLELLKVARSNNCNLILAGDERQLTSVERGGMFAVLASKFGSY
ELSRIRRQSKAWAREMASCFARSDITGGLRLLAQHDGLKIDHTLEESMARLINDWSNSKFALNERLIITM
RNAEVDSINQGIRELLKARGLLTGKEYRRYLSSEKHEDYMAGDRILFKSTNKDLQIENGEFATITSVSND
KFIAKTDSGKEIEFNPQDVSFKHGYASTVYKAQGASIKNVYVLHNLAGNSRNSYVAMTRHIEEVKLYYNR
KATRNMASLISQLSKIDNRLSSINFKTLEELVAIQDQENKSPNIIDKVGDWFKGVVEDIKDRLHSNDNYY
HLRVRSRSSAKVAEILRSTSTNFATSHKAQEERKSSSYNLTNCNKQDTTISVKLQEDIMAKNKIDYNAIN
KQKAVELKQRLSFKAEEIGRNLLGSPNNHLSSSHILRWGKDGKIAMKINGSKAGRWYDFSKGEGGDLFTL
VQREKNCDFVEAKKYLQDMVGISNNSKLLEDKIKEQFDQKVKNQDQQAKYAEISKIKRAEELYEKSDSII
YTTPNNIAKKYLLEHRGIKKILTGYQLNNDLRTNMMWDSNSKQYYPALIAFARNKDGNITGGQSIYLNKE
TNNKADIEVNKRSFGRIRGSFVEINKTNEQQNVQSRNVQSSKDGNNSVSNITIIAEGVETALSIREAGIK
GKILCSLGVSNIRNYEPIKGERIIIAADNDGKDAVSVNTVIKAQEELIRQGATVAIIRPPEKGDFNDMLK
SQGAESINKLIEAEIAKLTAASKVTELKSSLKASDDRKSQIKSIELLFSKFANNDNNGLNNLQQQQIKAL
AKFGTAENIDTALQIYREKGIDSCTAYSNKICIAAIEQKIQKDLQIMQNKFDPNYNLGDKKFCDIVVHDF
QGKSHLVPEDYLNAIGRDKQVMQYISPSSEIGKEIRSAVKQVSEIKLNQGIRV
 
Nucleotide Sequence: 4152 bp     [Download]
>gi|157826385|ref|NC_009883.1|:c1077641-1073490 Rickettsia bellii OSU 85-389 chromosome, complete genome
ATGGCAATACAGTTTGCAAGAATAGAAATAGTGAGTAGGAGTTCAGGAGGAAATGCTTGCCTGAAAGCTG
CCTATAATGCCAGGCTGATTATTAAAGATGAGAGAACTAACGTTACTTATAATTTTAGCAAAAAAGGCGA
TAATGTTTACCATGCAGTATTATTGCCTAATTATGTAGATAAAAGATTTAAAGACCCAAGGGTCTTGATG
AATGAAGTAGAACGTCTAGAGACAAGAAAAAATAGTCAATTATTAAAAGATATAGTTATAGCACTGCCTG
ATGATAAAGAGCTAGATTTAAATGATAGGATAGCCATTACTCATGAAATAATCGAAGAGATGGGGTGGGT
AAAGAATGGTCTAGGAGTTCAAATTGATATTCATCAGCCACATGATGGAGATAAGAATTGGCATGCCCAT
TTGCTTGTTACTACCAGAAGATTCACAGAAGATGGTAAATCTTTAGGAGCTAAGGCAGTAGATTTAAATC
CTAAATTTGCCAAAGTTAAGGGCAAAGCATTCATTATCCCAGAGGAGGAAATAATACATAAGAGAGTTAA
AGAAGTAATCAATAAATATTTTGCTAAGTTAGGTTTAGAAATCCAAGTAGACCCGATAAGTTTTATGCCT
CAGCAGCATGTTGGTCCTACTAGAATGCGAAGTATTATCAATGAAATAGCTGAGCAAAATAAAATATGTA
AATTAGCTCATCTGGAAATTATTAAAAATAGTGATGGAGTGTTAAATCGTATTATTCGTCATCAAGCTAT
TTTTACTAAATTGGATATAGAAAAAGCAATAAAAGAGATTCCAGAAGAAGTAGAAAAGTCAAAACTAATA
AGGGAGGTATTAAATTCAGATAGGCTGGTAAAACTATATAATGAAGATGGCACGGATACTAAATACTATA
CTACTAAAGACATAAGGGATGAAGAATTAAGGTTACTTAGAATAGCATATAAGGTAAATAACCAGATTCA
TTTTAATAATATTATTAAGCTTAAAAGTGCTATCGATAATCTTGCAAGTGTTAATGAAGCACAAAGAGAA
AGTCTACAGCATATTTTAATTAATAATCAAGGGATTAGGATTTTACAAGGTAGAGCCGGTACCGGTAAGT
CACAAGTACTTGTGCAGGCTTATAAAATTGCCACTAATCATGGGCAAAATATTATAGGGCTTAGTCCTAC
TCATAAAGCAGCATCAGAGCTTAAAAGTAAAGGTTACCGGCAATGTTATACAGTAAAAGGATTTTTATTT
AAATTATATAATGGCAAAGCTGATCTACCAAGAAATAGCCTGCTAGTAGTAGATGAAGCAGGGATGGTAG
GTAATAGTGATTATTTAGAATTACTAAAAGTAGCAAGGAGTAACAATTGTAATCTAATACTGGCTGGAGA
TGAGAGACAACTCACTTCCGTTGAGCGAGGAGGAATGTTTGCAGTATTGGCTAGTAAATTTGGCTCATAT
GAGTTAAGTAGAATTAGAAGACAGAGTAAAGCATGGGCAAGAGAAATGGCTTCATGCTTTGCAAGATCAG
ATATTACTGGTGGCTTGCGTTTACTTGCACAACATGATGGTTTAAAGATTGATCATACGCTAGAAGAATC
AATGGCAAGATTAATTAATGATTGGAGCAACAGCAAATTTGCTCTAAATGAGCGTTTAATAATTACCATG
CGTAATGCTGAAGTAGATAGTATTAATCAAGGCATCAGGGAGTTACTAAAAGCTAGAGGCTTACTTACCG
GTAAAGAATATAGACGTTATCTATCATCTGAAAAGCATGAAGATTATATGGCAGGAGATCGTATTTTGTT
TAAAAGTACAAATAAAGATTTACAAATAGAAAATGGTGAATTTGCAACGATAACTTCAGTAAGTAATGAT
AAATTTATTGCTAAAACAGATAGCGGGAAAGAAATAGAATTTAATCCTCAAGATGTAAGCTTTAAACATG
GCTATGCTTCTACAGTGTATAAAGCACAAGGAGCCTCAATTAAAAATGTCTATGTATTACATAATTTAGC
AGGAAATAGCAGAAATTCTTATGTAGCCATGACTAGACATATAGAAGAGGTAAAACTTTACTATAATAGG
AAGGCTACCAGGAATATGGCCAGTTTAATATCGCAACTTAGCAAAATAGATAATAGGCTATCTAGCATTA
ATTTTAAAACTTTAGAAGAATTAGTAGCGATTCAAGATCAAGAAAATAAGAGTCCTAATATTATAGATAA
AGTAGGTGATTGGTTTAAAGGGGTAGTAGAAGATATTAAGGATAGATTACACAGTAATGATAACTATTAC
CACTTAAGAGTGAGATCAAGATCATCTGCTAAGGTAGCAGAAATCCTAAGAAGCACTAGCACAAATTTTG
CCACAAGCCATAAAGCCCAAGAAGAGCGAAAAAGCTCTTCTTATAACCTTACGAATTGTAATAAACAAGA
TACAACAATAAGTGTTAAATTACAAGAGGATATTATGGCAAAGAATAAAATAGATTATAATGCTATTAAT
AAACAAAAAGCAGTAGAATTAAAGCAACGATTATCATTTAAAGCGGAAGAAATAGGTAGAAATTTGCTAG
GCAGTCCAAATAACCACTTATCGAGTAGTCACATATTACGCTGGGGAAAAGATGGTAAGATAGCGATGAA
GATAAATGGCAGTAAAGCTGGCAGATGGTATGATTTTAGTAAAGGAGAGGGAGGAGATTTATTTACCTTA
GTACAAAGAGAAAAAAATTGTGATTTTGTAGAAGCTAAGAAATATTTACAAGATATGGTTGGTATATCAA
ACAATAGCAAGTTATTAGAAGATAAGATAAAAGAGCAATTTGACCAAAAAGTTAAGAATCAAGATCAACA
AGCGAAATATGCTGAAATATCTAAGATAAAGAGAGCTGAAGAATTATATGAAAAATCAGATTCTATAATC
TATACGACGCCAAATAATATAGCAAAAAAATATTTATTAGAACATCGTGGAATTAAAAAAATATTAACAG
GATATCAACTAAATAATGATCTTAGAACCAATATGATGTGGGACAGTAATAGCAAACAATATTATCCTGC
ATTAATTGCTTTTGCTAGAAATAAAGATGGTAATATTACCGGTGGACAATCAATTTATTTAAACAAAGAA
ACAAATAATAAAGCTGATATTGAGGTTAATAAACGTTCATTTGGTAGAATCAGAGGTTCTTTTGTTGAGA
TTAATAAAACTAACGAACAGCAGAACGTACAAAGCAGGAACGTACAAAGCAGTAAAGATGGCAATAATTC
AGTTAGTAATATAACGATTATAGCAGAAGGGGTAGAGACCGCTTTAAGTATTAGGGAAGCTGGTATTAAA
GGCAAAATTCTTTGTAGTTTAGGTGTAAGTAACATTAGGAACTATGAGCCTATCAAAGGAGAAAGAATAA
TAATTGCTGCCGATAATGACGGCAAAGACGCAGTATCAGTTAATACTGTAATTAAAGCACAGGAAGAATT
AATTAGGCAAGGAGCGACGGTAGCAATAATACGACCACCAGAAAAAGGCGATTTTAATGATATGTTAAAA
TCCCAAGGAGCAGAATCTATAAACAAGCTTATAGAAGCTGAAATAGCAAAATTAACAGCAGCTAGCAAAG
TAACAGAACTTAAATCATCCTTAAAAGCAAGTGATGATAGAAAATCACAAATTAAATCTATAGAATTATT
ATTTTCAAAATTTGCAAATAACGATAATAACGGACTAAATAATTTGCAGCAACAGCAAATAAAAGCTCTA
GCAAAGTTTGGCACAGCAGAAAATATCGATACTGCTTTACAAATCTACAGAGAAAAAGGTATAGATTCTT
GTACTGCTTATAGTAACAAGATTTGCATAGCAGCAATAGAGCAGAAGATACAGAAAGATTTACAAATTAT
GCAGAATAAATTTGATCCTAATTATAATCTTGGTGATAAAAAATTTTGTGATATAGTAGTACATGATTTT
CAAGGCAAAAGCCATCTCGTCCCTGAAGATTACTTAAATGCCATAGGAAGAGATAAACAAGTAATGCAAT
ATATAAGTCCAAGCTCAGAAATAGGTAAAGAAATAAGAAGTGCGGTAAAGCAAGTATCTGAGATCAAGCT
AAATCAAGGAATAAGAGTTTAG
 Primer design