SecReT4
Protein ID: 157828263
T4SS name [ID]VirB [489]
Gene symbol-
Locus tagA1G_02210
StrainRickettsia rickettsii str. 'Sheila Smith'
Repliconchromosome [GenBank: NC_009882] [Browse all T4SS(s) in this replicon]
Location [Strand]389576..390274 [-]
ProductvirB8 protein
Component typeVirB8
UniProt IDQ7WUV7, A8GRH2
KEGG IDrri:A1G_02210
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.5e-17, Aligned region: 21..222
Protein Sequence: 232 a.a.     [Download]
>gi|157828263|ref|YP_001494505.1| virB8 protein [Rickettsia rickettsii str. 'Sheila Smith']
MDPLTNAIQEYIKSGEYFIDARKWYNFKYILPFSHRSLLLLICTIFTLLLTLVCININILLPINKKVNYL
IKDDAEKQAAITNTKHSTLVKPYTSIANIMLQNYVNQREEYNYDILKEQFTFIKNASTRIVYMQFANFMN
IDNPLSPVIRYQKLYRRSINILSIKNINDNEAVVTFESLAKNSTGAILENMVWEARIGFIMDSISTNTSP
DMPFNFTVTSYKLKLLRNKNQK
 
Nucleotide Sequence: 699 bp     [Download]
>gi|157827862|ref|NC_009882.1|:c390274-389576 Rickettsia rickettsii str. 'Sheila Smith' chromosome, complete genome
ATGGACCCATTAACCAACGCAATACAAGAATATATAAAATCCGGCGAATATTTTATTGATGCAAGAAAAT
GGTATAATTTTAAGTATATCTTACCGTTCAGTCATAGAAGTCTTCTGCTTTTAATATGCACGATTTTTAC
CTTATTATTAACCTTAGTTTGTATAAATATCAACATATTGCTTCCTATAAATAAAAAAGTAAATTATTTA
ATAAAAGATGATGCCGAAAAACAAGCTGCCATTACTAATACTAAACATTCAACATTAGTAAAGCCTTATA
CCTCTATTGCAAATATTATGCTTCAGAATTATGTAAACCAACGAGAAGAATACAATTACGATATATTAAA
AGAACAATTTACCTTTATCAAAAATGCTTCTACGCGTATTGTGTATATGCAATTTGCTAATTTTATGAAT
ATTGATAACCCATTATCACCGGTCATAAGATATCAAAAACTATATAGACGCTCAATTAATATATTATCAA
TTAAAAATATAAACGATAACGAGGCAGTTGTTACTTTTGAATCACTGGCAAAAAATAGTACGGGTGCAAT
TTTAGAAAATATGGTATGGGAAGCAAGAATCGGATTTATAATGGATTCTATCAGTACCAATACATCACCT
GATATGCCGTTCAATTTTACCGTTACTAGTTACAAGCTAAAGTTATTAAGGAATAAAAATCAGAAATAA
 Primer design