SecReT4
Protein ID: 157828265
T4SS name [ID]VirB [489]
Gene symbol-
Locus tagA1G_02220
StrainRickettsia rickettsii str. 'Sheila Smith'
Repliconchromosome [GenBank: NC_009882] [Browse all T4SS(s) in this replicon]
Location [Strand]390968..391699 [+]
Producthypothetical protein
Component typeVirB8
UniProt IDA8GRH4
KEGG IDrri:A1G_02220
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.4e-44, Aligned region: 37..241
Protein Sequence: 243 a.a.     [Download]
>gi|157828265|ref|YP_001494507.1| hypothetical protein A1G_02220 [Rickettsia rickettsii str. 'Sheila Smith']
MNNIFGFFKSSNNSQSGSGDTQTQESIKSANPLKMTQNWYEERSDKLLVQRNLLIILIILLTIFMVIATL
VIAFVVKSKQFEPFVIQLNSNTGRASVVEPISSPVLTADESLTRYFIKKYITARETYNPVDFATIARTTI
RLFSTSSVYYNYLGYIRNKDFDPTLKYKEANTTFLVIKSWSKIAADKYIVRFSVNETSGNQLVYNKIAVV
SYAYVPMQLTDSELDVNPVGFQVNGYRVDDDNS
 
Nucleotide Sequence: 732 bp     [Download]
>gi|157827862|ref|NC_009882.1|:390968-391699 Rickettsia rickettsii str. 'Sheila Smith' chromosome, complete genome
ATGAATAATATATTTGGCTTCTTTAAATCAAGTAATAACTCGCAAAGCGGTTCAGGAGATACACAAACGC
AAGAAAGTATTAAATCGGCTAATCCTTTAAAAATGACTCAGAATTGGTATGAAGAGCGATCTGATAAGTT
ACTTGTTCAACGTAACTTGCTTATCATATTAATAATACTACTAACCATTTTTATGGTTATAGCAACTTTA
GTAATAGCCTTTGTAGTGAAATCTAAACAGTTTGAGCCTTTTGTTATTCAGCTTAATAGTAATACCGGAC
GTGCCTCAGTGGTAGAACCTATTTCATCACCAGTGTTAACGGCGGATGAGTCTCTTACAAGGTATTTTAT
AAAGAAATACATAACGGCACGGGAAACATATAATCCGGTTGATTTTGCAACGATAGCTCGTACGACAATA
AGATTATTTTCAACAAGCAGTGTTTATTACAATTATCTTGGCTATATAAGAAATAAAGATTTTGATCCTA
CTTTAAAATATAAAGAAGCAAATACTACATTTTTAGTAATAAAATCATGGTCAAAAATCGCAGCAGATAA
ATATATAGTTAGATTTTCCGTAAATGAAACATCAGGAAACCAATTAGTTTATAATAAAATAGCGGTAGTA
AGTTATGCTTATGTGCCTATGCAATTAACAGATTCAGAACTTGATGTAAATCCGGTAGGGTTTCAAGTGA
ACGGATATAGGGTAGACGATGACAATAGTTAG
 Primer design