SecReT4
Protein ID: 157828268
T4SS name [ID]VirB [489]
Gene symbol-
Locus tagA1G_02235
StrainRickettsia rickettsii str. 'Sheila Smith'
Repliconchromosome [GenBank: NC_009882] [Browse all T4SS(s) in this replicon]
Location [Strand]393787..394791 [+]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDQ7WUV4, A8GRH7
KEGG IDrri:A1G_02235
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.1e-93, Aligned region: 13..311
Protein Sequence: 334 a.a.     [Download]
>gi|157828268|ref|YP_001494510.1| type IV secretion system ATPase VirB11 [Rickettsia rickettsii str. 'Sheila Smith']
MSEEFAALETFLLPFKNLFAEDGINEIMVNKPGEVWVEKKGDIYSKQIPELDSEHLLALGSLVAQSTEQM
ISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYAIRKPNGMNLTLDEYAKMGAFDDTATESLVDEDAVIL
NNFLAEKKIKEFIRHAVVSKKNIIISGGTSTGKTTFTNAALTEIPSIERLITVEDAREVVLSRHPNRVHL
LASKGGQGRANVTTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLK
LMVMQADLGMPPEEVKKYILTVVDIVVQLKRGSGGKRYVSEVYYKKNKNAEGMV
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|157827862|ref|NC_009882.1|:393787-394791 Rickettsia rickettsii str. 'Sheila Smith' chromosome, complete genome
ATGAGTGAAGAATTTGCAGCCTTAGAGACGTTTTTACTTCCTTTTAAAAATTTATTTGCTGAAGACGGTA
TTAACGAAATTATGGTTAATAAGCCTGGAGAAGTATGGGTTGAAAAAAAAGGCGATATATATTCTAAGCA
AATACCGGAACTGGATAGCGAACATCTACTTGCATTAGGGAGTTTAGTCGCTCAATCTACCGAACAGATG
ATTTCAGAAGAAAAACCGCTTCTTTCGGCAACTTTGCCGAATGGCTACCGTATTCAAATAGTATTTCCTC
CTGCTTGTGAGATAGGACAAATCATTTATGCTATAAGAAAGCCTAACGGTATGAATCTAACTTTAGATGA
ATATGCTAAAATGGGGGCATTTGATGATACTGCAACAGAGAGTTTAGTAGATGAAGATGCAGTAATTTTA
AATAATTTCTTAGCTGAAAAAAAGATTAAAGAATTTATTAGACATGCAGTTGTTTCAAAGAAAAATATCA
TAATTAGCGGCGGTACTTCAACCGGTAAAACTACTTTTACTAATGCGGCACTCACTGAAATACCTTCAAT
AGAAAGATTAATTACTGTAGAAGATGCTCGTGAGGTTGTGCTATCACGTCATCCTAACAGAGTGCATTTG
CTGGCTTCCAAAGGAGGACAGGGGCGTGCAAATGTTACTACTCAAGATTTAATAGAGGCCTGTTTGCGTT
TAAGACCAGATAGGATTATAGTAGGTGAGCTTCGAGGTAAGGAAGCTTTTAGTTTTTTGCGTGCTATTAA
TACAGGTCATCCCGGTTCAATATCCACACTGCATGCTGATAGTCCCGCTATGGCTATTGAGCAGTTAAAG
CTTATGGTTATGCAAGCAGATCTTGGTATGCCGCCTGAAGAAGTAAAGAAGTATATTTTAACCGTTGTAG
ATATCGTTGTGCAGTTAAAACGCGGTAGCGGCGGGAAAAGATATGTTTCGGAAGTATATTATAAGAAGAA
CAAGAACGCTGAGGGGATGGTTTAA
 Primer design