SecReT4
Protein ID: 157964361
T4SS name [ID]VirB [487]
Gene symbolvirB8-1
Locus tagRMA_0396
StrainRickettsia massiliae MTU5
Repliconchromosome [GenBank: NC_009900] [Browse all T4SS(s) in this replicon]
Location [Strand]399227..399952 [-]
Productvirulence protein
Component typeVirB8
UniProt IDA8F152
KEGG IDrms:RMA_0396
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.4e-17, Aligned region: 30..231
Protein Sequence: 241 a.a.     [Download]
>gi|157964361|ref|YP_001499185.1| virulence protein [Rickettsia massiliae MTU5]
MKLDINLVIMDPLTNAIQEYIKSGEYFIDARKWYNFKYILPLSHRSLLLLICTIFTLLLTLICININILL
PTNQKVSYLIKDDAEKQAAITNTKHSTLANPYISVANIMLQNYVNQREEYNYDILKEQFTFIKNASTSIV
YMQFANFMHIDNPLSPVIRYQKLYRRSINILSINNINDNEAVVTFESLAKNSTGAILENMVWEARIGFIM
DSISTSTSPDMPFNFTVTSYKLKLLRNKNQK
 
Nucleotide Sequence: 726 bp     [Download]
>gi|157964072|ref|NC_009900.1|:c399952-399227 Rickettsia massiliae MTU5 chromosome, complete genome
ATAAAATTAGATATTAATCTAGTAATTATGGACCCATTAACCAACGCAATACAAGAATATATAAAATCCG
GCGAATATTTTATTGATGCAAGAAAATGGTATAATTTTAAGTATATCTTACCGTTAAGTCATAGAAGTCT
TCTGCTTTTAATATGCACGATTTTTACCTTATTATTAACCTTAATTTGTATAAATATCAACATATTGCTA
CCAACCAACCAAAAAGTAAGTTATTTAATAAAAGATGATGCCGAAAAACAAGCTGCCATTACTAATACTA
AACATTCAACATTAGCAAATCCTTATATCTCTGTTGCAAATATTATGCTTCAGAATTATGTAAACCAACG
AGAAGAATACAATTACGATATATTAAAAGAACAATTTACCTTTATCAAAAATGCTTCTACGAGTATTGTT
TATATGCAATTTGCTAATTTTATGCATATTGATAACCCATTATCACCGGTCATAAGATATCAAAAACTAT
ATAGACGCTCAATTAATATATTATCAATTAACAATATAAACGATAACGAGGCAGTTGTTACTTTTGAATC
ATTGGCAAAAAATAGTACGGGTGCAATTTTAGAAAATATGGTATGGGAAGCAAGAATCGGATTTATAATG
GATTCTATCAGTACAAGTACATCACCTGATATGCCGTTCAATTTTACCGTTACTAGTTACAAGCTAAAGT
TATTAAGGAATAAAAATCAGAAATAA
 Primer design