SecReT4
Protein ID: 157964363
T4SS name [ID]VirB [487]
Gene symbolvirB8-2
Locus tagRMA_0398
StrainRickettsia massiliae MTU5
Repliconchromosome [GenBank: NC_009900] [Browse all T4SS(s) in this replicon]
Location [Strand]400622..401353 [+]
Productvirulence protein
Component typeVirB8
UniProt IDA8F154
KEGG IDrms:RMA_0398
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.9e-44, Aligned region: 37..241
Protein Sequence: 243 a.a.     [Download]
>gi|157964363|ref|YP_001499187.1| virulence protein [Rickettsia massiliae MTU5]
MNNIFGFFKSSNNSQSGSGDTQTQESIKSANPLKITQNWYEERSDKLLVQRNLLIILIILLTIFMVISTL
VIAFVVKSKQFDPFVIQLNSNTGRASVVEPISSPVLTTDESLTRYFIKKYITARETYNPVDFATIARTTI
RLFSTSSVYYNYLGYIRNKDFDPTLKYKEENTTFLVIKSWSKIAADKYIVRFSVNETSGNQLVYNKIAVV
SYAYVPMQLTDSELDVNPVGFQVNGYRVDDDNS
 
Nucleotide Sequence: 732 bp     [Download]
>gi|157964072|ref|NC_009900.1|:400622-401353 Rickettsia massiliae MTU5 chromosome, complete genome
ATGAATAATATATTTGGCTTCTTTAAATCAAGTAATAACTCGCAAAGCGGTTCAGGAGATACACAAACGC
AAGAAAGTATTAAATCGGCTAATCCTTTAAAAATTACTCAGAATTGGTATGAAGAGCGATCTGATAAGTT
ACTTGTTCAACGTAACTTACTTATCATATTAATAATACTACTAACCATTTTTATGGTTATCTCAACTTTA
GTAATAGCATTTGTAGTAAAATCTAAACAGTTTGATCCTTTTGTTATTCAGCTTAATAGTAATACCGGAC
GTGCCTCGGTGGTAGAACCTATTTCATCACCGGTGTTAACGACGGATGAGTCTCTTACAAGGTATTTTAT
AAAGAAATACATAACGGCACGGGAAACATATAATCCGGTTGATTTTGCGACGATAGCTCGTACGACAATA
AGATTATTTTCAACAAGCAGTGTTTATTACAATTATCTTGGCTATATAAGAAATAAAGATTTTGATCCTA
CTTTAAAATATAAAGAAGAGAATACTACATTTTTAGTAATAAAATCATGGTCAAAAATCGCAGCAGATAA
ATATATAGTTAGATTTTCCGTAAATGAAACATCAGGAAACCAATTAGTTTATAATAAAATAGCGGTAGTA
AGTTATGCTTATGTGCCTATGCAATTAACAGATTCAGAACTTGATGTAAATCCGGTAGGGTTTCAAGTTA
ACGGATATAGGGTAGACGATGACAATAGTTAG
 Primer design