SecReT4
Protein ID: 157964366
T4SS name [ID]VirB [487]
Gene symbolvirB11
Locus tagRMA_0401
StrainRickettsia massiliae MTU5
Repliconchromosome [GenBank: NC_009900] [Browse all T4SS(s) in this replicon]
Location [Strand]403397..404440 [+]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDA8F157
KEGG IDrms:RMA_0401
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.4e-93, Aligned region: 26..324
Protein Sequence: 347 a.a.     [Download]
>gi|157964366|ref|YP_001499190.1| type IV secretion system ATPase VirB11 [Rickettsia massiliae MTU5]
MPKSHFIKIEGNEMNEEFAALETFLLPFKNLFAEGGINEIMVNKPGEVWVEKKGDIYSQQIPELDSEHLL
ALGRLVAQSTEQMISEEKPLLSATLPNGYRVQIVFPPACEIGQIIYAIRKPSGMTLTLDEYAKMGAFDDT
ATESLVDEDAVILNNFLAEKKIKEFIRHAVVSKKNIIISGGTSTGKTTFTNAALTEIPAIERLITVEDAR
EVVLSSHPNRVHLLASKGGQGRANVTTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTL
HADSPAMAIEQLKLMVMQADLGMPPEEVKKYILTVVDIVVQLKRGSGGKRYVSEVYYKKNKNVEGMV
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|157964072|ref|NC_009900.1|:403397-404440 Rickettsia massiliae MTU5 chromosome, complete genome
ATTCCCAAAAGCCATTTTATTAAAATCGAAGGTAATGAAATGAATGAAGAATTTGCAGCCTTAGAGACGT
TTTTACTTCCTTTTAAAAATTTATTTGCTGAAGGCGGTATTAACGAAATTATGGTTAATAAGCCCGGAGA
AGTATGGGTTGAAAAAAAAGGCGATATATATTCTCAGCAAATACCGGAACTGGATAGCGAACATCTACTT
GCATTAGGGCGTTTAGTCGCTCAATCTACCGAACAGATGATTTCAGAAGAAAAACCGCTTCTTTCGGCAA
CTTTACCGAATGGCTACCGTGTTCAAATAGTATTTCCTCCTGCTTGTGAGATAGGACAAATCATTTATGC
TATAAGAAAGCCTAGCGGTATGACTCTAACTTTAGATGAATATGCTAAAATGGGGGCATTTGATGATACT
GCAACAGAGAGTTTAGTAGATGAAGATGCAGTAATTTTAAATAATTTCTTAGCTGAAAAAAAGATTAAAG
AATTTATTAGACATGCAGTTGTTTCAAAGAAAAATATCATAATTAGCGGCGGTACTTCAACCGGTAAAAC
TACTTTTACTAATGCGGCACTTACTGAAATACCTGCAATAGAAAGATTAATTACTGTAGAAGATGCTCGT
GAGGTTGTGCTATCAAGCCATCCTAACAGAGTGCATTTACTGGCTTCCAAAGGAGGACAAGGGCGTGCAA
ATGTTACTACTCAAGATTTAATAGAGGCCTGTTTGCGTTTAAGACCAGATAGGATTATAGTAGGTGAGCT
TCGAGGTAAGGAAGCTTTTAGTTTTTTGCGTGCTATTAATACAGGTCACCCCGGTTCAATATCAACACTG
CATGCTGATAGTCCCGCTATGGCTATTGAGCAGTTAAAGCTTATGGTTATGCAAGCAGATCTTGGTATGC
CGCCTGAAGAAGTAAAGAAGTATATTTTAACCGTTGTAGATATTGTTGTGCAGTTAAAACGCGGTAGCGG
CGGGAAAAGATATGTTTCGGAAGTATATTATAAGAAGAACAAGAACGTTGAGGGGATGGTTTAA
 Primer design