SecReT4
Protein ID: 157964367
T4SS name [ID]VirB [487]
Gene symbolvirD4
Locus tagRMA_0402
StrainRickettsia massiliae MTU5
Repliconchromosome [GenBank: NC_009900] [Browse all T4SS(s) in this replicon]
Location [Strand]404607..406382 [+]
Producttype IV secretion system protein VirB8
Component typeVirD4
UniProt IDA8F158
KEGG IDrms:RMA_0402
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5.9e-166, Aligned region: 120..567
TraG-D_C [PF12696], Evalue: 3e-28, Aligned region: 404..526
TrwB_AAD_bind [PF10412], Evalue: 8.4e-22, Aligned region: 237..535
AAA_10 [PF12846], Evalue: 2.6e-05, Aligned region: 155..481
Protein Sequence: 591 a.a.     [Download]
>gi|157964367|ref|YP_001499191.1| type IV secretion system protein VirB8 [Rickettsia massiliae MTU5]
MEWHKILKVTRNIFGHAIIHPVVIFCTIWISGAFVTIFTNEVGALGVDINAINIAYKWAYWLINVWGQLK
IADYNYLKLKLLASLLGPAIIVIIFYIKNFERIKSLQFFKQDEKVYGDASWANPSDIEAAGLRSKKGMLI
GVDAGGYFVADGFQHALLFAPTGSGKGVGFVIPNLLFWSDSVVVHDIKLENHGLTSGWREKQGQKVFVWE
PSNPDGVTHCYNPIDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADPTKTKSFGEV
VRTMRSDDVVYNLAVVLDTLGGVIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANPLIDSATASSD
FNIQEFKKVKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPDLKEEPYGVMFLLDEFPTLGKMDTF
KAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLSNATYRITFAANNYETANLISQLVGNKTVEQRS
FSKPLFFDLNISTRTQNVSQVQRALLLPQEVIQLPRDEQIVLIESFPPIKSRKIKYYEDKFFTSRLLPPT
FVPTQVPFDPRANNNESSEETETITVPENNE
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|157964072|ref|NC_009900.1|:404607-406382 Rickettsia massiliae MTU5 chromosome, complete genome
ATGGAATGGCATAAGATACTTAAAGTTACTAGAAATATATTCGGTCATGCTATAATTCATCCGGTTGTTA
TTTTTTGTACCATTTGGATAAGCGGTGCATTTGTTACAATTTTTACTAATGAGGTTGGAGCTTTAGGTGT
AGATATAAATGCTATAAATATTGCTTATAAGTGGGCGTACTGGCTTATTAATGTTTGGGGGCAGTTAAAA
ATTGCCGACTATAATTATTTAAAATTGAAGCTACTTGCCTCTCTTCTCGGTCCAGCTATTATTGTTATAA
TATTTTACATTAAAAATTTTGAAAGAATAAAATCATTACAATTTTTCAAACAAGATGAAAAAGTATATGG
AGATGCAAGCTGGGCTAATCCGTCAGATATAGAGGCTGCAGGTCTTAGATCTAAGAAAGGTATGCTGATC
GGTGTGGATGCCGGTGGATATTTTGTTGCAGACGGGTTCCAGCATGCTTTATTATTTGCTCCTACCGGTT
CAGGTAAAGGTGTAGGGTTTGTGATACCTAACTTGTTATTTTGGAGTGATTCGGTAGTAGTGCATGACAT
AAAGCTCGAAAATCACGGGTTGACAAGTGGTTGGCGTGAGAAGCAAGGGCAGAAAGTTTTTGTATGGGAG
CCTTCTAATCCTGATGGTGTTACTCATTGTTATAATCCGATTGATTGGGTTAGTACCAAACCTGGTCAAA
TGGTTGATGACGTTCAAAAAATTTCAAATCTTATAATGCCGGAAAAGGATTTTTGGAATAATGAGGCACG
AAGCTTATTTTTAGGCGTAACTCTATATTTAATAGCCGATCCTACTAAAACTAAATCTTTCGGTGAAGTA
GTGCGTACTATGAGGAGTGACGACGTAGTTTATAATCTAGCGGTCGTACTCGATACGCTTGGTGGTGTAA
TACATCCTGTTGCATATATGAATATTGCTGCATTTTTGCAAAAAGCCGATAAAGAGCGTTCCGGCGTAAT
ATCTACAATGAACTCATCGCTTGAATTATGGGCAAATCCACTTATTGATTCAGCTACAGCATCTTCTGAT
TTCAATATACAAGAATTTAAAAAAGTAAAAACAACCGTATATGTAGGGTTAACACCCGATAATATACAGC
GTTTACAAAAATTAATGCAGGTGTTTTATCAGCAGGCGACAGAATTTTTAAGCCGCAAAATGCCGGATTT
AAAGGAAGAGCCGTATGGAGTAATGTTCTTACTTGACGAGTTCCCGACGCTTGGGAAGATGGATACTTTT
AAAGCCGGTATAGCTTATTTTAGAGGTTATAGAGTTCGTTTATTTTTAATTATTCAAGATACGCAGCAGT
TAAAAGGAACATATGAAGATGCAGGGATGAATTCTTTCTTATCTAATGCAACATATCGTATTACTTTTGC
CGCTAATAACTATGAAACGGCAAATTTAATATCGCAGCTTGTCGGTAATAAGACGGTAGAACAAAGATCA
TTTAGTAAACCTTTATTTTTTGATCTTAATATTTCTACTAGAACCCAAAACGTTTCTCAGGTTCAAAGAG
CTTTACTTTTACCTCAAGAAGTAATACAGTTACCGAGAGATGAGCAAATTGTTTTAATAGAATCCTTTCC
GCCTATAAAATCTCGTAAAATTAAGTATTACGAAGATAAGTTTTTTACTAGTAGATTATTACCGCCGACT
TTTGTACCTACTCAAGTACCTTTTGACCCTAGGGCAAATAATAATGAGTCTTCTGAAGAGACCGAAACAA
TAACTGTTCCGGAAAACAATGAGTAA
 Primer design