SecReT4
Protein ID: 157964590
T4SS name [ID]Tra_F [553]
Gene symboltraE
Locus tagRMA_0717
StrainRickettsia massiliae MTU5
Repliconchromosome [GenBank: NC_009900] [Browse all T4SS(s) in this replicon]
Location [Strand]710788..711342 [+]
Productconjugative transfer protein TraE
Component typeTraE_F
UniProt IDA8F1T1
KEGG IDrms:RMA_0717
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.9e-14, Aligned region: 1..174
Protein Sequence: 184 a.a.     [Download]
>gi|157964590|ref|YP_001499414.1| conjugative transfer protein TraE [Rickettsia massiliae MTU5]
MDHLFKQSSIQQLVKYNKRLLLITLLLAVTSLLGMIKTVSTEEKWLLIPAMEPDRRMIVSSKSYHETYLK
EWAVFVMKELFTTSPEEVERQIADMKVVSSNTEQLDKFFKEHLDFVKGSNISSVFFPKKVKVIADGVLIN
GTFRYWFSENKHVATDKTYLLTYKRGANHLLLLTGIKEEEVNKQ
 
Nucleotide Sequence: 555 bp     [Download]
>gi|157964072|ref|NC_009900.1|:710788-711342 Rickettsia massiliae MTU5 chromosome, complete genome
ATGGATCATTTATTTAAGCAAAGCTCCATTCAGCAGCTAGTTAAGTATAATAAGAGATTATTGCTTATCA
CATTGCTGCTTGCAGTTACGAGTCTTCTTGGGATGATTAAAACAGTTAGCACGGAAGAAAAATGGTTATT
AATTCCGGCAATGGAGCCAGATCGCCGGATGATAGTATCATCCAAAAGCTATCATGAGACATATCTTAAA
GAATGGGCAGTTTTTGTAATGAAAGAATTATTTACTACTTCACCTGAGGAAGTAGAGAGGCAAATAGCGG
ATATGAAGGTGGTATCTAGTAATACAGAGCAATTGGATAAATTTTTTAAGGAACATTTAGATTTTGTTAA
AGGCTCTAATATTTCATCGGTATTTTTTCCTAAAAAAGTAAAAGTCATTGCGGATGGAGTATTAATTAAT
GGAACATTTCGTTATTGGTTTTCCGAGAATAAGCATGTTGCAACTGATAAAACTTATTTGTTAACCTACA
AGCGAGGAGCAAATCATTTGTTGTTACTTACTGGTATTAAAGAAGAAGAGGTAAATAAGCAATGA
 Primer design