SecReT4
Protein ID: 157964593
T4SS name [ID]Tra_F [553]
Gene symboltraB
Locus tagRMA_0720
StrainRickettsia massiliae MTU5
Repliconchromosome [GenBank: NC_009900] [Browse all T4SS(s) in this replicon]
Location [Strand]712111..713523 [+]
ProductF pilus assembly protein TraB
Component typeTraB_F
UniProt IDA8F1T4
KEGG IDrms:RMA_0720
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.8e-37, Aligned region: 192..396
Protein Sequence: 470 a.a.     [Download]
>gi|157964593|ref|YP_001499417.1| F pilus assembly protein TraB [Rickettsia massiliae MTU5]
MDQDFNKQKELQSTVEDHKLPSAFSKRLSGLIEIIKNRPLVTLACIGVIMVLVFYGLSESEVKASRGLQE
ERQAREISGIEKAIDPRAKWTAEILNEVKNMQNHLEKLIENKYLETKTKIDDFSQKLESLEKPREETILY
DGNDFNNNQKIEDLLDNNFEQSIAAAPTAPVKRLLGYVKRADLESQKDVKDYITTGSFARGLLLTGVVVG
TGTNNAASPEPIMVRLVDTAIFSKGYKTEQIKEAILIGSCTGDISSERAKCRLETVSLLNNHGKIIEKPV
EGWLIGEDGRPGIKGIVVDRSSDVARMAVLNGVLGGIAQFFQNQATNSVFPVSPITGQQNALKAQDSLKA
GVYAGTGNALEKLADFAIKRAESMSPVIVVASGRVIDVVFRKGFDLRENKEASKVDRLLPPTITDYSQNS
TNYSNYQNYAGNKVTSFTKAKTKLPERFIKNDDEMTDIDLRSEQQYPGNF
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|157964072|ref|NC_009900.1|:712111-713523 Rickettsia massiliae MTU5 chromosome, complete genome
ATGGATCAAGATTTCAATAAGCAGAAAGAATTACAAAGTACAGTAGAGGATCATAAATTACCATCTGCAT
TTAGTAAAAGATTATCAGGACTCATAGAGATAATTAAAAACAGACCATTAGTAACTCTAGCTTGCATAGG
AGTAATAATGGTTTTGGTATTTTATGGATTGTCAGAAAGTGAGGTAAAAGCTTCCCGAGGTTTACAAGAA
GAGAGACAAGCAAGGGAAATATCTGGAATAGAAAAGGCCATAGATCCAAGGGCAAAATGGACTGCAGAAA
TATTAAATGAAGTTAAAAACATGCAGAATCATTTAGAGAAGTTAATAGAGAATAAATATTTAGAAACTAA
AACTAAAATTGATGATTTTAGTCAAAAGTTAGAATCCTTAGAGAAGCCTCGTGAAGAAACTATATTATAT
GATGGCAATGATTTTAATAATAATCAAAAAATAGAAGATTTATTAGATAATAACTTTGAGCAAAGCATTG
CTGCTGCTCCTACTGCTCCAGTAAAAAGATTACTTGGTTATGTAAAAAGAGCTGACTTGGAGTCCCAAAA
AGACGTTAAAGATTATATTACTACTGGCAGCTTTGCACGGGGGTTGCTGCTTACTGGCGTGGTGGTTGGA
ACCGGCACTAATAATGCAGCTTCACCTGAGCCTATAATGGTAAGGCTTGTTGATACAGCTATTTTTTCTA
AAGGATATAAAACGGAGCAAATCAAAGAAGCAATTTTAATTGGTTCATGCACTGGGGATATTTCATCAGA
GCGGGCTAAATGCCGGTTAGAGACAGTATCTTTACTAAATAATCATGGCAAGATAATTGAAAAACCGGTA
GAAGGATGGTTAATAGGTGAAGATGGTAGACCTGGCATTAAAGGGATAGTAGTTGATAGATCATCAGATG
TAGCAAGGATGGCGGTGCTTAACGGCGTACTTGGCGGGATAGCACAATTTTTCCAGAACCAGGCAACAAA
TAGCGTATTTCCGGTGTCACCGATTACCGGTCAGCAAAATGCCTTAAAAGCTCAGGATTCTCTAAAAGCC
GGTGTTTATGCCGGCACCGGTAATGCTTTAGAAAAGCTTGCTGATTTTGCCATTAAACGAGCAGAAAGCA
TGAGTCCGGTAATTGTTGTAGCTTCAGGTAGAGTAATAGATGTAGTATTTAGAAAAGGTTTTGATTTAAG
AGAGAATAAAGAGGCTTCTAAAGTAGATAGATTACTGCCACCAACTATTACTGATTATTCGCAAAATAGC
ACAAATTATAGTAATTATCAAAATTATGCCGGTAATAAAGTGACAAGTTTTACTAAGGCAAAAACTAAAT
TGCCAGAACGTTTTATTAAGAATGATGATGAAATGACAGATATTGATTTGCGGTCAGAACAACAATATCC
GGGTAATTTTTAA
 Primer design