SecReT4
Protein ID: 157964594
T4SS name [ID]Tra_F [553]
Gene symboltraV
Locus tagRMA_0721
StrainRickettsia massiliae MTU5
Repliconchromosome [GenBank: NC_009900] [Browse all T4SS(s) in this replicon]
Location [Strand]713523..713762 [+]
Productconjugative transfer protein TraV
Component typeTraV_F
UniProt IDA8F1T5
KEGG IDrms:RMA_0721
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 79 a.a.     [Download]
>gi|157964594|ref|YP_001499418.1| conjugative transfer protein TraV [Rickettsia massiliae MTU5]
MNNKIINLLLLLMLSFSVANCKLMPYRSDFDCPLPQGLKCKSLYEVNKMADLDMFNPNNNNDKPNFKSRC
STRCFGGYN
 
Nucleotide Sequence: 240 bp     [Download]
>gi|157964072|ref|NC_009900.1|:713523-713762 Rickettsia massiliae MTU5 chromosome, complete genome
ATGAATAATAAAATAATTAATCTGCTGTTGTTATTAATGTTAAGCTTTAGCGTTGCTAATTGTAAGTTGA
TGCCATATAGAAGCGATTTTGATTGCCCGCTGCCCCAAGGGTTAAAATGTAAATCTTTATATGAAGTAAA
TAAAATGGCAGATCTTGATATGTTTAATCCAAATAATAATAATGATAAGCCTAATTTTAAATCGAGATGC
TCTACTAGATGCTTTGGAGGGTATAATTAA
 Primer design