SecReT4
Protein ID: 157964595
T4SS name [ID]Tra_F [553]
Gene symbol-
Locus tagRMA_0722
StrainRickettsia massiliae MTU5
Repliconchromosome [GenBank: NC_009900] [Browse all T4SS(s) in this replicon]
Location [Strand]713762..716281 [+]
Productconjugative transfer protein TraC
Component typeTraC_F
UniProt IDA8F1T6
KEGG IDrms:RMA_0722
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 3.7e-52, Aligned region: 462..750
TraC_F_IV [PF11130], Evalue: 1.4e-37, Aligned region: 11..214
FtsK_SpoIIIE [PF01580], Evalue: 4.3e-05, Aligned region: 457..499
Protein Sequence: 839 a.a.     [Download]
>gi|157964595|ref|YP_001499419.1| conjugative transfer protein TraC [Rickettsia massiliae MTU5]
MTSGIDKDFTRERLAKHFVYESYDEESSLFFNRASVGFVLLGWPLVGTSLQAQGEIAEFLKSDENLPAGS
SFQILMIGSDHIREYLDNWQLHRKGSIFAELSSRRTKFLQAKAKEEGNIKDVVLLISVTIPTLTIDINEM
IRRREVLQDTFKSIGLTTYNVEATLLLKFVRLIFGWREEEHPELNPYEILSEQILPGNFSLYEKEDYVAL
NDNQIFISLEAGKRPLEWRLSAMDLFLGNELRRDEYIRSNFLIHFGLQIIPNQLVAKTAAITKREALERN
INAGMGKFFPNLASEAQDLAGAVAYLQSGDRVVNIHLNVIMWDKKNKAKGSASQFCSQLRRSGWYFVPCK
YDHLAVVLASLPMQLVEAAPNSLMGKFNRFNNIFNKKTQGVGVALSNLGRGIKTIASESKVLLPIIGEWK
GDLSSPGMLLTGRRGQIMYWSPFGSALIGSNLYSTAAAPNENFNLCIAGVPGSGKSVFMQELMLSILGIG
GKVFVLDYGRSFKRTCLLLGGNYIEFDVKNPISINPFSEIPADGSEGSIEAQADFLASFPSILATMAAPQ
YGTNDLQQPMLQKALIAVWQAKGARAEITDIADWLLKREESYAQELGNMLFPFTRDGQYGKFFSGKAKLS
LNSDIVVIETDHLRSSPALLAVIVQIMIVHINQAMVKGDRKRPFLIMIDEAWKLLSGKRSGEFIEEAGRI
ARKYNGSITLATQQLTDYFREAGSAAEKAFENSSHKVILKQNPESFKAMRANPKLAGFVDEDWKLNLLQS
IHSSPPHYSEAAIYGPSVHGVVARLMLDPFTLMLTSTNARDYRALEDRMIAGMSVTEAINNILQERGLA
 
Nucleotide Sequence: 2520 bp     [Download]
>gi|157964072|ref|NC_009900.1|:713762-716281 Rickettsia massiliae MTU5 chromosome, complete genome
ATGACATCAGGAATTGATAAAGATTTTACTCGGGAAAGACTAGCTAAACATTTTGTTTATGAATCATATG
ATGAGGAGAGTAGCTTGTTTTTTAATAGAGCTTCAGTAGGATTTGTCCTGCTTGGCTGGCCATTAGTTGG
GACAAGCTTGCAAGCTCAAGGAGAGATAGCTGAATTTTTAAAAAGTGATGAGAATTTACCGGCAGGAAGT
AGTTTTCAAATATTGATGATTGGCTCTGATCATATAAGAGAATATCTAGATAACTGGCAATTACATAGAA
AAGGCAGCATCTTTGCTGAGCTTAGCAGTAGAAGAACAAAATTTTTGCAAGCAAAAGCAAAGGAAGAGGG
AAATATCAAAGATGTAGTTTTATTAATTTCAGTCACTATTCCGACGCTGACGATTGATATTAATGAGATG
ATACGAAGAAGAGAAGTATTGCAAGATACATTTAAATCAATTGGGCTTACTACTTATAATGTTGAGGCAA
CATTGCTATTAAAATTTGTCCGTTTAATATTTGGCTGGAGGGAAGAAGAACATCCTGAACTTAATCCTTA
TGAAATATTATCTGAGCAGATTTTACCCGGTAATTTTTCTTTATATGAAAAGGAAGATTATGTTGCTCTT
AATGACAATCAAATATTTATAAGCTTAGAGGCAGGAAAAAGACCGCTCGAGTGGCGATTATCGGCAATGG
ATTTGTTTTTAGGTAATGAGCTAAGACGAGATGAATATATTAGATCAAATTTTCTGATTCATTTTGGTTT
GCAGATTATACCAAATCAATTAGTTGCAAAAACAGCAGCAATTACCAAAAGAGAAGCTTTAGAGAGAAAT
ATTAATGCCGGGATGGGTAAGTTTTTTCCTAACTTAGCCAGTGAAGCACAAGATTTAGCAGGAGCAGTAG
CGTATTTACAAAGCGGCGATCGAGTAGTAAATATCCACTTAAATGTCATTATGTGGGATAAGAAGAACAA
AGCCAAAGGATCAGCATCACAGTTTTGCTCACAGCTTCGTCGAAGTGGCTGGTATTTTGTCCCTTGTAAA
TATGATCATTTAGCAGTAGTGCTTGCTAGTTTACCGATGCAGTTAGTTGAAGCAGCACCTAATTCTTTAA
TGGGTAAATTTAATAGATTCAATAATATATTTAATAAAAAGACTCAGGGAGTTGGCGTAGCATTATCAAA
TCTTGGTAGAGGCATCAAGACTATTGCCTCAGAAAGTAAGGTGTTGCTGCCTATCATTGGTGAATGGAAA
GGGGATTTAAGCTCTCCTGGCATGCTGCTTACTGGTAGAAGAGGACAGATAATGTATTGGTCGCCCTTTG
GTTCAGCATTAATTGGTTCAAATTTATATAGCACAGCTGCAGCTCCAAATGAAAATTTTAATCTTTGTAT
AGCAGGAGTACCAGGATCTGGTAAATCAGTGTTTATGCAGGAGTTAATGCTATCAATTTTGGGTATAGGC
GGCAAAGTATTTGTTCTTGATTATGGTAGATCATTTAAAAGAACCTGTTTGCTACTGGGCGGTAATTATA
TTGAATTTGATGTAAAAAATCCTATTTCTATTAATCCATTTTCAGAAATTCCAGCAGACGGCAGCGAAGG
CTCAATTGAAGCACAGGCAGATTTTCTTGCAAGTTTTCCATCAATTCTAGCAACCATGGCAGCTCCTCAG
TATGGAACTAATGATTTGCAGCAACCAATGCTACAAAAGGCCTTAATAGCTGTCTGGCAAGCAAAAGGAG
CACGAGCTGAGATAACTGACATAGCAGATTGGTTGCTTAAAAGAGAAGAATCTTACGCACAGGAACTTGG
TAATATGTTATTTCCATTCACCAGAGATGGGCAATATGGCAAGTTTTTTAGTGGTAAGGCAAAATTATCA
CTAAATTCAGATATAGTAGTAATTGAAACTGATCATCTTCGTAGTAGCCCGGCATTACTTGCAGTAATTG
TACAAATCATGATTGTGCATATTAACCAAGCAATGGTTAAAGGTGATAGGAAGCGTCCCTTTCTAATCAT
GATTGATGAAGCATGGAAATTACTATCTGGCAAGAGATCTGGAGAATTTATTGAAGAAGCAGGTAGAATA
GCTAGAAAATACAACGGCTCAATTACTCTTGCTACTCAGCAATTAACTGATTACTTCAGGGAAGCAGGAT
CGGCTGCTGAAAAAGCTTTTGAGAACTCATCACATAAAGTTATTCTTAAGCAAAATCCTGAGAGCTTTAA
AGCAATGAGAGCCAACCCCAAACTTGCAGGTTTTGTCGATGAGGACTGGAAGCTAAATTTACTGCAGTCT
ATTCATTCAAGTCCACCGCATTATAGTGAAGCAGCAATTTATGGACCAAGTGTTCATGGAGTTGTGGCAA
GATTAATGCTAGATCCATTTACTCTAATGCTGACCTCTACTAATGCTAGGGATTATAGGGCTTTAGAAGA
TAGAATGATTGCGGGAATGAGCGTTACAGAGGCGATTAATAATATTCTGCAAGAAAGAGGTTTGGCTTAA
 Primer design