SecReT4
Protein ID: 157964597
T4SS name [ID]Tra_F [553]
Gene symboltraU
Locus tagRMA_0726
StrainRickettsia massiliae MTU5
Repliconchromosome [GenBank: NC_009900] [Browse all T4SS(s) in this replicon]
Location [Strand]719018..719998 [+]
Productconjugal DNA transfer protein TraU
Component typeTraU_F
UniProt IDA8F1T8
KEGG IDrms:RMA_0726
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 6.7e-79, Aligned region: 29..324
Protein Sequence: 326 a.a.     [Download]
>gi|157964597|ref|YP_001499421.1| conjugal DNA transfer protein TraU [Rickettsia massiliae MTU5]
MQVIMKLIMFIIIILLGNYSYGSIGCVGRFVNPITDVCWKCLFPITIGGVKIVSSSMADTNNPRQIVCFC
PKPSIPMPVPGIPIGFWEPVRLVDVTKSPMCMVSLGGINLGTSMQKGVKDDIEGSSFYHVHWYIYPVIYW
LEILLDFACLEMSQVDITYLTEFDPLWGDDSKAAILNPESLLFGSIAAQSACIADCISSSSGNLSNDRVF
WCCGCQGSLYPFTGTTSSHNGGVGTSALIVAKFMAKLHRELLLWGYMGSSGLCGKYPMPIIKKSQYRLQM
TYPIPEVHSCKKIGETEISWQGAREFPVKGEDFGYLIWRKRSCCLF
 
Nucleotide Sequence: 981 bp     [Download]
>gi|157964072|ref|NC_009900.1|:719018-719998 Rickettsia massiliae MTU5 chromosome, complete genome
ATACAAGTAATAATGAAGTTAATAATGTTTATTATAATTATTTTGCTTGGTAATTATAGTTATGGATCAA
TTGGCTGCGTAGGTAGGTTTGTAAATCCAATCACTGATGTTTGCTGGAAATGTTTATTTCCAATTACTAT
CGGAGGAGTAAAAATTGTCTCAAGTTCTATGGCTGATACTAATAACCCAAGGCAAATTGTTTGTTTTTGC
CCTAAGCCTTCGATTCCGATGCCAGTTCCCGGTATTCCAATTGGATTCTGGGAGCCGGTAAGACTGGTGG
ATGTAACTAAATCCCCGATGTGCATGGTAAGCCTTGGAGGCATTAATCTTGGTACTAGCATGCAAAAAGG
TGTTAAGGATGATATAGAGGGAAGTAGCTTTTATCATGTACATTGGTATATATATCCGGTTATTTACTGG
CTTGAGATCTTACTTGATTTTGCCTGTTTAGAGATGTCACAAGTAGATATCACATATTTAACTGAATTTG
ATCCATTATGGGGAGACGATAGCAAAGCTGCCATATTAAATCCTGAAAGTTTATTATTTGGCAGTATTGC
AGCTCAAAGTGCATGTATAGCTGATTGCATTAGCTCTAGTTCTGGTAATCTTTCTAACGATAGGGTGTTT
TGGTGCTGTGGCTGTCAAGGTTCTCTTTATCCCTTTACCGGTACAACTAGCTCTCATAATGGCGGAGTTG
GAACTTCTGCATTAATAGTGGCTAAATTTATGGCTAAGTTACATAGAGAGTTGTTATTATGGGGATATAT
GGGGAGTAGCGGATTATGTGGTAAATATCCAATGCCAATAATCAAGAAGAGCCAATATAGACTGCAGATG
ACTTACCCTATACCAGAGGTGCATTCTTGTAAAAAGATTGGTGAGACTGAAATAAGCTGGCAGGGTGCAC
GCGAATTCCCAGTTAAAGGTGAGGATTTTGGTTATTTGATCTGGCGTAAACGCAGTTGCTGTTTATTTTG
A
 Primer design