SecReT4
Protein ID: 157964598
T4SS name [ID]Tra_F [553]
Gene symboltrbC
Locus tagRMA_0727
StrainRickettsia massiliae MTU5
Repliconchromosome [GenBank: NC_009900] [Browse all T4SS(s) in this replicon]
Location [Strand]719983..720450 [+]
Productconjugative transfer protein TrbC
Component typeTrbC_F
UniProt IDA8F1T9
KEGG IDrms:RMA_0727
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1e-24, Aligned region: 57..150
Protein Sequence: 155 a.a.     [Download]
>gi|157964598|ref|YP_001499422.1| conjugative transfer protein TrbC [Rickettsia massiliae MTU5]
MLFILICKIFIKLRSMQFNLKIIILTSLLILGSTNVLAEQEELLQEIIQPKTYNQIYIFVSLSMPDSALK
SYYIEAEQAGARLVIRGLKNSSFLDTKAKADEINISFDIDPNLFEEYQITSVPAIIVNSEGKGVKRLTGH
ISLHDALEIMNKENL
 
Nucleotide Sequence: 468 bp     [Download]
>gi|157964072|ref|NC_009900.1|:719983-720450 Rickettsia massiliae MTU5 chromosome, complete genome
TTGCTGTTTATTTTGATTTGTAAAATTTTTATAAAATTGAGAAGTATGCAATTTAACCTAAAAATAATAA
TTTTAACTAGTTTACTAATTTTAGGTAGCACAAATGTTTTGGCAGAGCAAGAAGAATTATTACAGGAGAT
AATACAGCCTAAAACATATAATCAAATCTACATTTTTGTCTCATTGTCAATGCCTGATTCAGCATTAAAG
AGTTATTATATTGAAGCAGAACAAGCAGGAGCAAGACTGGTAATACGAGGTTTAAAAAATAGTTCTTTTT
TAGATACTAAAGCAAAAGCTGATGAAATTAATATTAGTTTTGATATTGATCCCAATCTATTTGAGGAATA
TCAAATTACTTCTGTACCAGCAATAATAGTGAATAGTGAAGGCAAGGGAGTAAAAAGACTCACTGGTCAC
ATATCATTACATGATGCATTAGAAATTATGAACAAAGAAAATTTATGA
 Primer design