SecReT4
Protein ID: 157964599
T4SS name [ID]Tra_F [553]
Gene symboltraN
Locus tagRMA_0728
StrainRickettsia massiliae MTU5
Repliconchromosome [GenBank: NC_009900] [Browse all T4SS(s) in this replicon]
Location [Strand]720420..722246 [+]
Productconjugative transfer protein TraN
Component typeTraN_F
UniProt IDA8F1U0
KEGG IDrms:RMA_0728
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1.7e-74, Aligned region: 306..548
Protein Sequence: 608 a.a.     [Download]
>gi|157964599|ref|YP_001499423.1| conjugative transfer protein TraN [Rickettsia massiliae MTU5]
MRNYEQRKFMRFAFLSMIIVLFSFNAIANIQDSYNQAIGYQNSIKLGNPDQMGNKVIFDKDADISNLSNM
SDQNLTKQGSQMLNNSSAGQLLQQGELKKIDASQEYDLNAKNPLISNSAKIEADPLRYTEGTALNASEKV
LKTKTSKSCCEGAEFEIDIIRNLILDAELIDKWGEWQDKAIAFSGSEISNSYRHWLYPVFWKKKRHFGKR
KTIYSMHMHNNQAIMLDVRAAIAGKLNVSLDHIDIYIGISSQGEGALTEGWDRDIVKWDRYVFTYKYRDK
IKEFREKGEYFQIVNKSLEALLEEHECHEINRICLEAGNKLFFNQYNVNRPCWSEQIKYQCSSEPKYGCD
HLKKQACELARSNCVKQAASICLQWHKDYICIAQKKEFSSSIAGSKMFCLGGNCHTATIVPNNDIASIGH
LAMLNEMKKDMQTNPIMVFKGTSDSCRKTNIGNFLNCCSGFKGWGKDLGLSRCSAEEKALALKRAKGQCY
YVGTYCAKKDKVFKTCITKKSTYCCFNSKLARVFQEQGKKQLAISFGTAQYANCRGFTVEELQRIDFSKF
DLEELFSDLLDHAKSKMSKSFPQQLKNQMPIMQQQRSNNNCTDSNLSY
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|157964072|ref|NC_009900.1|:720420-722246 Rickettsia massiliae MTU5 chromosome, complete genome
ATTAGAAATTATGAACAAAGAAAATTTATGAGGTTCGCATTTTTATCAATGATTATTGTATTGTTCAGTT
TTAATGCAATTGCTAACATTCAAGATAGTTATAATCAAGCAATAGGGTATCAAAATAGTATTAAGCTTGG
TAATCCTGATCAAATGGGCAATAAAGTAATATTTGATAAAGACGCAGATATTTCAAATTTAAGTAATATG
AGTGATCAAAATTTAACAAAGCAAGGTAGTCAAATGTTAAATAATAGTTCAGCAGGTCAATTACTACAAC
AAGGTGAGCTTAAAAAAATAGATGCTTCTCAAGAATATGACCTGAATGCTAAAAACCCTTTAATTAGTAA
TTCAGCTAAGATTGAGGCAGATCCTTTAAGGTATACAGAAGGGACTGCACTTAATGCTAGTGAAAAAGTA
TTGAAAACCAAAACAAGTAAGAGTTGCTGTGAAGGGGCAGAATTTGAAATAGATATTATCAGGAATCTTA
TACTAGATGCTGAATTAATAGATAAATGGGGAGAGTGGCAAGATAAAGCAATAGCATTTTCAGGTTCTGA
GATAAGTAACAGTTATCGTCACTGGCTTTATCCTGTCTTTTGGAAAAAGAAAAGACATTTCGGTAAGCGT
AAAACAATATACAGCATGCATATGCATAATAATCAAGCAATAATGCTTGATGTAAGAGCAGCAATTGCCG
GTAAGTTAAATGTTTCTCTTGATCATATTGATATATATATTGGCATTTCTTCTCAAGGAGAAGGAGCGTT
AACTGAAGGCTGGGATAGAGATATAGTAAAATGGGATAGATATGTTTTTACTTATAAATATCGTGATAAA
ATCAAGGAATTTAGAGAAAAAGGTGAATATTTCCAAATAGTAAATAAATCTTTAGAAGCTTTGCTTGAAG
AACATGAATGCCATGAAATAAATCGCATATGTCTTGAAGCTGGTAATAAATTATTTTTTAATCAATATAA
TGTTAATCGTCCATGCTGGAGTGAGCAAATTAAATATCAATGTAGTAGTGAGCCAAAATATGGGTGTGAT
CATTTAAAGAAGCAAGCTTGTGAACTTGCAAGGAGCAATTGCGTTAAGCAAGCTGCTAGTATTTGTTTGC
AATGGCACAAAGATTACATATGTATAGCCCAGAAAAAAGAGTTTAGCTCCTCTATAGCAGGATCAAAAAT
GTTTTGTTTAGGAGGGAATTGTCATACTGCAACTATTGTGCCAAATAATGATATTGCAAGTATTGGGCAC
CTTGCCATGTTAAATGAAATGAAAAAAGATATGCAGACAAATCCGATTATGGTTTTTAAAGGTACAAGTG
ATAGTTGTCGTAAAACAAATATCGGTAATTTTCTTAATTGTTGTTCCGGATTTAAAGGCTGGGGCAAGGA
TTTAGGATTAAGTAGGTGCAGTGCAGAAGAAAAAGCTTTAGCCTTAAAAAGGGCAAAAGGTCAGTGCTAT
TATGTAGGTACATATTGTGCTAAGAAAGATAAGGTATTTAAGACATGTATTACCAAGAAATCTACTTATT
GTTGTTTTAATTCAAAGCTTGCAAGAGTATTTCAAGAACAAGGCAAAAAACAATTAGCTATTAGTTTTGG
CACGGCACAATATGCTAATTGCAGAGGGTTTACAGTAGAAGAACTACAAAGAATAGATTTTTCTAAGTTT
GATTTAGAGGAGCTATTTAGTGATTTACTTGATCATGCTAAAAGTAAAATGAGTAAGAGTTTTCCACAGC
AACTAAAAAATCAGATGCCTATAATGCAACAACAAAGGTCTAATAATAATTGTACTGATTCAAATTTATC
TTATTAA
 Primer design